Germany
Japan
United Kingdom
China
ASPA (Myc-DDK-tagged)-Human aspartoacylase (ASPA), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ASPA (Myc-DDK-tagged)-Human aspartoacylase (ASPA), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human aspartoacylase (Canavan disease) (ASPA), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
ASPA (GFP-tagged) - Human aspartoacylase (ASPA), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human aspartoacylase (ASPA), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ASPA (Myc-DDK tagged) - Human aspartoacylase (ASPA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human aspartoacylase (ASPA), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ASPA (mGFP-tagged) - Human aspartoacylase (ASPA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human aspartoacylase (ASPA), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ASPA (Myc-DDK tagged) - Human aspartoacylase (ASPA), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human aspartoacylase (ASPA), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ASPA (mGFP-tagged) - Human aspartoacylase (ASPA), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ASPA (GFP-tagged) - Human aspartoacylase (ASPA), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit polyclonal ASPA Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ASPA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 82-110 amino acids from the N-terminal region of human ASPA. |
Rabbit Polyclonal antibody to Aspartoacylase (aspartoacylase (Canavan disease))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 300 of Aspartoacylase (Uniprot ID#P45381) |
ASPA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ASPA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
ASPA (untagged)-Human aspartoacylase (ASPA), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal Anti-ASPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASPA antibody: synthetic peptide directed towards the N terminal of human ASPA. Synthetic peptide located within the following region: RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS |
Rabbit polyclonal Anti-ASPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASPA antibody: synthetic peptide directed towards the middle region of human ASPA. Synthetic peptide located within the following region: IKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADIL |
Aminoacylase-2 / ACY2 (1-313, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Aminoacylase-2 / ACY2 (1-313, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI3B5 (formerly 3B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ASPA MS Standard C13 and N15-labeled recombinant protein (NP_000040)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ASPA MS Standard C13 and N15-labeled recombinant protein (NP_001121557)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ASPA (untagged)-Human aspartoacylase (ASPA), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ASPA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASPA |
ASPA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ASPA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ASPA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ASPA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ASPA mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ASPA mouse monoclonal antibody, clone OTI4H4 (formerly 4H4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Active filters
Target Symbol
- ASPA
Pathways
- Histidine metabolism