Products

Antibodies (14)
cDNA Clones (14)
Proteins (8)
Jump to Filters
View as table Download
Monoamine Oxidase A (MAOA) (NM_000240) Human Tagged ORF Clone
RC207276

USD 420.00

In Stock

MAOA (Myc-DDK-tagged)-Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Monoamine Oxidase A (MAOA) Mouse Monoclonal Antibody [Clone ID: OTI2F10]
TA504266

USD 379.00

In Stock

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Monoamine Oxidase A (MAOA) (NM_000240) Human Tagged ORF Clone
RG207276

USD 460.00

In Stock

MAOA (GFP-tagged) - Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Monoamine Oxidase A (MAOA) Mouse Monoclonal Antibody [Clone ID: OTI1D6]
TA504265

USD 379.00

In Stock

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Monoamine Oxidase A (MAOA) (NM_000240) Human Tagged ORF Clone
RC207276L3

USD 620.00

3 Weeks

Lenti ORF clone of Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase A (MAOA) (NM_000240) Human Tagged ORF Clone Lentiviral Particle
RC207276L3V

USD 820.00

5 Weeks

Lenti ORF particles, MAOA (Myc-DDK tagged) - Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase A (MAOA) (NM_000240) Human Tagged ORF Clone
RC207276L4

USD 620.00

3 Weeks

Lenti ORF clone of Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase A (MAOA) (NM_000240) Human Tagged ORF Clone Lentiviral Particle
RC207276L4V

USD 820.00

7 Weeks

Lenti ORF particles, MAOA (mGFP-tagged) - Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase A (MAOA) (NM_001270458) Human Tagged ORF Clone
RC233972

USD 420.00

5 Weeks

MAOA (Myc-DDK tagged) - Homo sapiens monoamine oxidase A (MAOA), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Monoamine Oxidase A (MAOA) (NM_001270458) Human Tagged ORF Clone
RG233972

USD 460.00

5 Weeks

MAOA (GFP-tagged) - Homo sapiens monoamine oxidase A (MAOA), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Monoamine Oxidase A (MAOA) Mouse Monoclonal Antibody [Clone ID: OTI1D6]
CF504265

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MAOA mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Monoamine Oxidase A (MAOA) (NM_000240) Human Untagged Clone
SC126927

USD 310.00

In Stock

MAOA (untagged)-Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Monoamine Oxidase A (MAOA) Rabbit Polyclonal Antibody
TA327037

USD 275.00

3 Weeks

Rabbit anti-MAOA Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOA
Monoamine Oxidase A (MAOA) (NM_000240) Human Tagged ORF Clone
RC207276L1

USD 768.00

In Stock

Lenti ORF clone of Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Monoamine Oxidase A (MAOA) (NM_000240) Human Tagged ORF Clone
RC207276L2

USD 620.00

3 Weeks

Lenti ORF clone of Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Monoamine Oxidase A (MAOA) (NM_000240) Human Recombinant Protein
TP761773

USD 215.00

In Stock

Purified recombinant protein of Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
Monoamine Oxidase A (MAOA) Rabbit Polyclonal Antibody
AP20650PU-N

USD 407.00

2 Weeks

Monoamine Oxidase A (MAOA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Monoamine Oxidase A (MAOA) Goat Polyclonal Antibody
TA302539

USD 375.00

5 Days

Goat Polyclonal Antibody against Monoamine Oxidase A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DAPWEAQHADKWDK, from the internal region of the protein sequence according to NP_000231.1.
Monoamine Oxidase A (MAOA) Rabbit Polyclonal Antibody
TA335132

USD 375.00

5 Days

Rabbit polyclonal Anti-MAOA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAOA antibody: synthetic peptide directed towards the N terminal of human MAOA. Synthetic peptide located within the following region: GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
Monoamine Oxidase A (MAOA) Rabbit Polyclonal Antibody
TA335133

USD 375.00

5 Days

Rabbit polyclonal Anti-MAOA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MAOA antibody: synthetic peptide directed towards the middle region of human MAOA. Synthetic peptide located within the following region: NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE
Amine Oxidase A / MAOA (1-497, His-tag) Human Protein
AR51841PU-N

USD 845.00

2 Weeks

Amine Oxidase A / MAOA (1-497, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Amine Oxidase A / MAOA (1-497, His-tag) Human Protein
AR51841PU-S

USD 330.00

2 Weeks

Amine Oxidase A / MAOA (1-497, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Monoamine Oxidase A (MAOA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D6]
TA504265AM

USD 420.00

4 Weeks

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Monoamine Oxidase A (MAOA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D6]
TA504265BM

USD 420.00

4 Weeks

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Monoamine Oxidase A (MAOA) Mouse Monoclonal Antibody [Clone ID: OTI1D6]
TA504265S

USD 159.00

2 Days

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Monoamine Oxidase A (MAOA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F10]
TA504266AM

USD 420.00

4 Weeks

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Monoamine Oxidase A (MAOA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F10]
TA504266BM

USD 420.00

4 Weeks

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Monoamine Oxidase A (MAOA) Mouse Monoclonal Antibody [Clone ID: OTI2F10]
TA504266S

USD 159.00

2 Days

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Monoamine Oxidase A (MAOA) ICC Control Block
TB407276

USD 1,070.00

4 Weeks

Transient overexpression of MAOA (NM_000240) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Monoamine Oxidase A (MAOA) ICC Control Block
TB433972

USD 1,070.00

4 Weeks

Transient overexpression of MAOA (NM_001270458) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Monoamine Oxidase A (MAOA) Cytosection
TS407276

USD 225.00

4 Weeks

Transient overexpression of MAOA (NM_000240) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Monoamine Oxidase A (MAOA) Cytosection
TS407276P5

USD 889.00

4 Weeks

Transient overexpression of MAOA (NM_000240) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Monoamine Oxidase A (MAOA) ICC Control Sections
TS433972P5

USD 889.00

4 Weeks

Transient overexpression of MAOA (NM_001270458) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack