Germany
Japan
United Kingdom
China
Maoa (Myc-DDK-tagged) - Mouse monoamine oxidase A (Maoa), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadMAOA (Myc-DDK-tagged)-Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, MAOA (Myc-DDK tagged) - Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, MAOA (mGFP-tagged) - Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 379.00
In Stock
MAOA (GFP-tagged) - Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 379.00
In Stock
Maoa - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN509710 is the updated version of KN309710.
Maoa (GFP-tagged) - Mouse monoamine oxidase A (Maoa)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Maoa (Myc-DDK-tagged) - Mouse monoamine oxidase A (Maoa), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Maoa (Myc-DDK-tagged) - Mouse monoamine oxidase A (Maoa), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Maoa (mGFP-tagged) - Mouse monoamine oxidase A (Maoa), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Maoa (GFP-tagged) - Mouse monoamine oxidase A (Maoa), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, MAOA (Myc-DDK tagged) - Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, MAOA (mGFP-tagged) - Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MAOA (Myc-DDK tagged) - Homo sapiens monoamine oxidase A (MAOA), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAOA (GFP-tagged) - Homo sapiens monoamine oxidase A (MAOA), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Maoa (myc-DDK-tagged) - Rat monoamine oxidase A (Maoa)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAOA (untagged)-Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Maoa (untagged) - Mouse monoamine oxidase A (Maoa), nuclear gene encoding mitochondrial protein, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Maoa (untagged) - Rat monoamine oxidase A (Maoa)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
MAOA (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Goat Polyclonal Antibody against Monoamine Oxidase A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DAPWEAQHADKWDK, from the internal region of the protein sequence according to NP_000231.1. |
Rabbit polyclonal Anti-MAOA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAOA antibody: synthetic peptide directed towards the N terminal of human MAOA. Synthetic peptide located within the following region: GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA |
Rabbit polyclonal Anti-MAOA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAOA antibody: synthetic peptide directed towards the middle region of human MAOA. Synthetic peptide located within the following region: NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE |
Maoa - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Amine Oxidase A / MAOA (1-497, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Amine Oxidase A / MAOA (1-497, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
MAOA CRISPRa kit - CRISPR gene activation of human monoamine oxidase A
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Maoa CRISPRa kit - CRISPR gene activation of mouse monoamine oxidase A
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene MAOA
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene MAOA
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qPCR primer pairs and template standards against Mus musculus gene Maoa
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Maoa
MAOA (untagged) - Homo sapiens monoamine oxidase A (MAOA), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Maoa (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
MAOA Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MAOA |
USD 380.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- MAOA