Germany
Japan
United Kingdom
China
EME1 (Myc-DDK-tagged)-Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
EME1 (Myc-DDK-tagged)-Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of EME1 (Myc-DDK-tagged)-Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, EME1 (Myc-DDK-tagged)-Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of EME1 (mGFP-tagged)-Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, EME1 (mGFP-tagged)-Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of EME1 (Myc-DDK-tagged)-Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, EME1 (Myc-DDK-tagged)-Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of EME1 (mGFP-tagged)-Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, EME1 (mGFP-tagged)-Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
EME1 (GFP-tagged) - Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EME1 (GFP-tagged) - Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EME1 (untagged)-Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
EME1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-EME1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EME1 antibody: synthetic peptide directed towards the N terminal of human EME1. Synthetic peptide located within the following region: MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS |
Rabbit Polyclonal Anti-EME1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EME1 antibody: synthetic peptide directed towards the middle region of human EME1. Synthetic peptide located within the following region: AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR |
EME1 (untagged)-Human essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1) transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of EME1 (NM_152463) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EME1 (NM_001166131) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EME1 (NM_152463) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EME1 (NM_152463) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of EME1 (NM_001166131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EME1 (NM_001166131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- EME1
Pathways
- Homologous recombination