Products

View as table Download

AP2B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

AP2B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, AP2B1 (Myc-DDK tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, AP2B1 (mGFP-tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

AP2B1 (GFP-tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AP2B1 (Myc-DDK tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AP2B1 (mGFP-tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AP2B1 (Myc-DDK tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AP2B1 (mGFP-tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

AP2B1 (GFP-tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit anti-AP2B1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AP2B1

Lenti ORF clone of Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Beta 2 Adaptin Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

AP2B1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

AP2B1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

AP2B1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY420031 is the same product as LY429059.

AP2B1 (untagged)-Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

AP2B1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 516-546 amino acids from the Central region of human AP2B1

AP2B1 (untagged)-Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-AP2B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the middle region of human AP2B1. Synthetic peptide located within the following region: SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP

Rabbit Polyclonal Anti-AP2B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the C terminal of human AP2B1. Synthetic peptide located within the following region: GAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVV

Rabbit Polyclonal Anti-AP2B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the middle region of human AP2B1. Synthetic peptide located within the following region: DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSI

AP2B1 MS Standard C13 and N15-labeled recombinant protein (NP_001025177)

Tag C-Myc/DDK
Expression Host HEK293

AP2B1 MS Standard C13 and N15-labeled recombinant protein (NP_001273)

Tag C-Myc/DDK
Expression Host HEK293

USD 1,070.00

4 Weeks

Transient overexpression of AP2B1 (NM_001030006) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,680.00

4 Weeks

Transient overexpression of AP2B1 (NM_001282) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of AP2B1 (NM_001030006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of AP2B1 (NM_001030006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of AP2B1 (NM_001282) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of AP2B1 (NM_001282) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack