Products

cDNA Clones (15)
Proteins (6)
Antibodies (2)
Jump to Filters
View as table Download
REST (NM_005612) Human Tagged ORF Clone
RC211570

USD 880.00

In Stock

REST (Myc-DDK-tagged)-Human RE1-silencing transcription factor (REST), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
REST (NM_005612) Human Tagged ORF Clone
RG211570

USD 970.00

In Stock

REST (GFP-tagged) - Human RE1-silencing transcription factor (REST), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
REST (NM_005612) Human Tagged ORF Clone Lentiviral Particle
RC211570L1V

USD 1,280.00

3 Weeks

Lenti ORF particles, REST (Myc-DDK tagged) - Human RE1-silencing transcription factor (REST), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
REST (NM_005612) Human Tagged ORF Clone Lentiviral Particle
RC211570L2V

USD 1,280.00

3 Weeks

Lenti ORF particles, REST (mGFP-tagged) - Human RE1-silencing transcription factor (REST), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
REST (NM_005612) Human Tagged ORF Clone Lentiviral Particle
RC211570L4V

USD 1,280.00

3 Weeks

Lenti ORF particles, REST (mGFP-tagged) - Human RE1-silencing transcription factor (REST), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
REST (NM_005612) Human Tagged ORF Clone
RC211570L4

USD 1,080.00

In Stock

Lenti ORF clone of Human RE1-silencing transcription factor (REST), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
REST (NM_005612) Human Tagged ORF Clone
RC211570L3

USD 1,080.00

3 Weeks

Lenti ORF clone of Human RE1-silencing transcription factor (REST), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
REST (NM_005612) Human Tagged ORF Clone Lentiviral Particle
RC211570L3V

USD 1,280.00

5 Weeks

Lenti ORF particles, REST (Myc-DDK tagged) - Human RE1-silencing transcription factor (REST), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
REST (NM_001193508) Human Tagged ORF Clone
RC235166

USD 880.00

8 Weeks

REST (Myc-DDK tagged) - Homo sapiens RE1-silencing transcription factor (REST), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
REST (NM_001193508) Human Tagged ORF Clone
RG235166

USD 970.00

8 Weeks

REST (GFP-tagged) - Homo sapiens RE1-silencing transcription factor (REST), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
REST (NM_005612) Human Tagged Lenti ORF Clone
RC211570L2

USD 1,332.00

In Stock

Lenti ORF clone of Human RE1-silencing transcription factor (REST), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
REST (NM_005612) Human Tagged ORF Clone
RC211570L1

USD 1,332.00

In Stock

Lenti ORF clone of Human RE1-silencing transcription factor (REST), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
REST (NM_005612) Human Untagged Clone
SC116634

USD 1,100.00

In Stock

REST (untagged)-Human RE1-silencing transcription factor (REST), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
REST (NM_005612) Human Untagged Clone
SC318496

USD 1,100.00

In Stock

REST (untagged)-Human RE1-silencing transcription factor (REST), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
REST Rabbit Polyclonal Antibody
TA324112

USD 345.00

4 Weeks

Anti-REST Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.873~877(R-E-E-A-S) derived from Human REST.
REST Rabbit Polyclonal Antibody
TA330562

USD 375.00

5 Days

Rabbit Polyclonal Anti-REST Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-REST antibody: synthetic peptide directed towards the middle region of human REST. Synthetic peptide located within the following region: PMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSD
REST (NM_001193508) Human Untagged Clone
SC331167

USD 1,110.00

8 Weeks

REST (untagged) - Homo sapiens RE1-silencing transcription factor (REST), transcript variant 2

Vector pCMV6 series
Tag Tag Free
REST ICC Control Block
TB411570

USD 1,530.00

4 Weeks

Transient overexpression of REST (NM_005612) in HEK293T cells paraffin embedded controls for ICC/IHC staining

REST ICC Control Block
TB435166

USD 1,530.00

4 Weeks

Transient overexpression of REST (NM_001193508) in HEK293T cells paraffin embedded controls for ICC/IHC staining

REST Cytosection
TS411570

USD 225.00

4 Weeks

Transient overexpression of REST (NM_005612) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

REST Cytosection
TS411570P5

USD 889.00

4 Weeks

Transient overexpression of REST (NM_005612) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

REST Cytosection
TS435166

USD 225.00

4 Weeks

Transient overexpression of REST (NM_001193508) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

REST Cytosection
TS435166P5

USD 889.00

4 Weeks

Transient overexpression of REST (NM_001193508) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack