Germany
Japan
United Kingdom
China
CACNA2D1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CACNA2D1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CACNA2D1 (mGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CACNA2D1 (GFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CACNA2D1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CACNA2D1 (mGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CACNA2D1 (myc-DDK-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CACNA2D1 (untagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CACNA2D1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CACNA2D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNA2D1 antibody: synthetic peptide directed towards the middle region of human CACNA2D1. Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI |
Transient overexpression of CACNA2D1 (NM_000722) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Goat Polyclonal Antibody against CACNA2D1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QEIFNKYNKDKKVR, from the internal region of the protein sequence according to NP_000713.2. |
CACNA2D1 (GFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CACNA2D1 (untagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of CACNA2D1 (NM_001302890) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), Asp253-Leu430, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of CACNA2D1 (NM_000722) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CACNA2D1 (NM_001302890) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CACNA2D1
Pathways
- Hypertrophic cardiomyopathy (HCM)