Products

cDNA Clones (11)
Proteins (7)
Antibodies (4)
Jump to Filters
View as table Download
Myosin light chain 3 (MYL3) (NM_000258) Human Tagged ORF Clone
RG203122

USD 460.00

In Stock

MYL3 (GFP-tagged) - Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Myosin light chain 3 (MYL3) (NM_000258) Human Tagged ORF Clone Lentiviral Particle
RC203122L3V

USD 820.00

5 Weeks

Lenti ORF particles, MYL3 (Myc-DDK tagged) - Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Myosin light chain 3 (MYL3) (NM_000258) Human Tagged ORF Clone Lentiviral Particle
RC203122L4V

USD 820.00

7 Weeks

Lenti ORF particles, MYL3 (mGFP-tagged) - Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Myosin light chain 3 (MYL3) Rabbit Polyclonal Antibody
TA346031

USD 475.00

5 Days

Rabbit Polyclonal Anti-MYL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYL3 antibody: synthetic peptide directed towards the N terminal of human MYL3. Synthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG
Myosin light chain 3 (MYL3) Rabbit Polyclonal Antibody
DP2015

USD 405.00

2 Weeks

Myosin light chain 3 (MYL3) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Recombinant human myosin (cardiac) light chain fragment.
Myosin light chain 3 (MYL3) (NM_000258) Human Tagged ORF Clone
RC203122L2

USD 620.00

3 Weeks

Lenti ORF clone of Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Myosin light chain 3 (MYL3) (NM_000258) Human Untagged Clone
SC122554

USD 310.00

In Stock

MYL3 (untagged)-Human myosin, light chain 3, alkali, ventricular, skeletal, slow (MYL3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Myosin light chain 3 (MYL3) (NM_000258) Human Over-expression Lysate
LC400098

USD 121.00

In Stock

MYL3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Myosin light chain 3 (MYL3) Rabbit Polyclonal Antibody
TA311754

USD 345.00

4 Weeks

Rabbit polyclonal anti-MYL3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MYL3.
Myosin light chain 3 (MYL3) (NM_000258) Human Over-expression Lysate
LY400098

USD 396.00

5 Days

Transient overexpression lysate of myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Myosin light chain 3 (MYL3) (NM_000258) Human Mass Spec Standard
PH303122

USD 2,055.00

3 Weeks

MYL3 MS Standard C13 and N15-labeled recombinant protein (NP_000249)

Tag C-Myc/DDK
Expression Host HEK293
Myosin light chain 3 (MYL3) Rabbit Polyclonal Antibody
TA350194

USD 345.00

In Stock

Rabbit Polyclonal Anti-MYL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYL3
Myosin light chain 3 (MYL3) ICC Control Block
TB403122

USD 1,040.00

4 Weeks

Transient overexpression of MYL3 (NM_000258) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Myosin light chain 3 (MYL3) Cytosection
TS403122

USD 225.00

4 Weeks

Transient overexpression of MYL3 (NM_000258) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Myosin light chain 3 (MYL3) Cytosection
TS403122P5

USD 889.00

4 Weeks

Transient overexpression of MYL3 (NM_000258) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack