USD 98.00
USD 390.00
In Stock
MYL3 (Myc-DDK-tagged)-Human myosin, light chain 3, alkali, ventricular, skeletal, slow (MYL3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 98.00
USD 390.00
In Stock
MYL3 (Myc-DDK-tagged)-Human myosin, light chain 3, alkali, ventricular, skeletal, slow (MYL3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, MYL3 (Myc-DDK tagged) - Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, MYL3 (mGFP-tagged) - Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
MYL3 (GFP-tagged) - Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, MYL3 (Myc-DDK tagged) - Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, MYL3 (mGFP-tagged) - Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MYL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYL3 antibody: synthetic peptide directed towards the N terminal of human MYL3. Synthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG |
Myosin light chain 3 (MYL3) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Immunogen | Recombinant human myosin (cardiac) light chain fragment. |
Lenti ORF clone of Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
MYL3 (untagged)-Human myosin, light chain 3, alkali, ventricular, skeletal, slow (MYL3)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
MYL3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit polyclonal anti-MYL3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MYL3. |
Transient overexpression lysate of myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
MYL3 MS Standard C13 and N15-labeled recombinant protein (NP_000249)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-MYL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MYL3 |
Transient overexpression of MYL3 (NM_000258) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYL3 (NM_000258) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MYL3 (NM_000258) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack