Germany
Japan
United Kingdom
China
USD 420.00
In Stock
PIAS4 (Myc-DDK-tagged)-Human protein inhibitor of activated STAT, 4 (PIAS4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 823.00
In Stock
Recombinant protein of human protein inhibitor of activated STAT, 4 (PIAS4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 460.00
In Stock
PIAS4 (GFP-tagged) - Human protein inhibitor of activated STAT, 4 (PIAS4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 620.00
3 Weeks
Lenti ORF clone of Human protein inhibitor of activated STAT, 4 (PIAS4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PIAS4 (Myc-DDK tagged) - Human protein inhibitor of activated STAT, 4 (PIAS4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti ORF clone of Human protein inhibitor of activated STAT, 4 (PIAS4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PIAS4 (mGFP-tagged) - Human protein inhibitor of activated STAT, 4 (PIAS4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PIAS4 (untagged)-Human protein inhibitor of activated STAT, 4 (PIAS4)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PIAS4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS4 Antibody: A synthesized peptide derived from human PIAS4 |
PIAS4 (untagged)-Human protein inhibitor of activated STAT, 4 (PIAS4)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 121.00
In Stock
PIAS4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 396.00
In Stock
Transient overexpression lysate of protein inhibitor of activated STAT, 4 (PIAS4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-PIAS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIAS4 Antibody: synthetic peptide directed towards the N terminal of human PIAS4. Synthetic peptide located within the following region: AKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKK |
USD 2,055.00
3 Weeks
PIAS4 MS Standard C13 and N15-labeled recombinant protein (NP_056981)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of PIAS4 (NM_015897) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PIAS4 (NM_015897) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PIAS4 (NM_015897) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PIAS4
Pathways
- Jak-STAT signaling pathway