Products

cDNA Clones (13)
Proteins (9)
Antibodies (1)
Jump to Filters
View as table Download
l Afadin (AFDN) (NM_001040000) Human Tagged ORF Clone
RC217774

USD 1,270.00

In Stock

MLLT4 (Myc-DDK-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
l Afadin (AFDN) (NM_001040000) Human Tagged ORF Clone
RG217774

USD 1,400.00

In Stock

MLLT4 (GFP-tagged) - Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
l Afadin (AFDN) (NM_001040000) Human Tagged ORF Clone
RC217774L3

USD 1,470.00

3 Weeks

Lenti-ORF clone of MLLT4 (Myc-DDK-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
l Afadin (AFDN) (NM_001040000) Human Tagged ORF Clone Lentiviral Particle
RC217774L3V

USD 1,670.00

6 Weeks

Lenti ORF particles, MLLT4 (Myc-DDK-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
l Afadin (AFDN) (NM_001040000) Human Tagged ORF Clone
RC217774L4

USD 1,470.00

3 Weeks

Lenti-ORF clone of MLLT4 (mGFP-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
l Afadin (AFDN) (NM_001040000) Human Tagged ORF Clone Lentiviral Particle
RC217774L4V

USD 1,670.00

6 Weeks

Lenti ORF particles, MLLT4 (mGFP-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
l Afadin (AFDN) (NM_001207008) Human Tagged ORF Clone
RC235333

USD 1,830.00

10 Weeks

MLLT4 (Myc-DDK tagged) - Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
l Afadin (AFDN) (NM_001291964) Human Tagged ORF Clone
RC240207

USD 1,870.00

6 Weeks

MLLT4 (myc-DDK-tagged) - Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
l Afadin (AFDN) (NM_001207008) Human Tagged ORF Clone
RG235333

USD 2,010.00

10 Weeks

MLLT4 (GFP-tagged) - Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
l Afadin (AFDN) (NM_001040000) Human Untagged Clone
SC311059

USD 3,350.00

In Stock

MLLT4 (untagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
l Afadin (AFDN) (NM_001040000) Human Over-expression Lysate
LC421870

USD 187.00

In Stock

MLLT4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
l Afadin (AFDN) (NM_001040000) Human Over-expression Lysate
LY421870

USD 605.00

In Stock

Transient overexpression lysate of myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
l Afadin (AFDN) Rabbit Polyclonal Antibody
TA335978

USD 310.00

5 Days

Rabbit Polyclonal Anti-MLLT4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MLLT4 Antibody: synthetic peptide directed towards the N terminal of human MLLT4. Synthetic peptide located within the following region: GVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAE
l Afadin (AFDN) (NM_001291964) Human Tagged ORF Clone
RG240207

USD 1,910.00

2 Weeks

MLLT4 (GFP-tagged) - Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
l Afadin (AFDN) (NM_001207008) Human Untagged Clone
SC331731

USD 2,350.00

10 Weeks

MLLT4 (untagged) - Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 1

Vector pCMV6 series
Tag Tag Free
l Afadin (AFDN) (NM_001291964) Human Untagged Clone
SC338101

USD 1,800.00

6 Weeks

MLLT4 (untagged) - Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
l Afadin (AFDN) ICC Control Block
TB417774

USD 1,920.00

4 Weeks

Transient overexpression of MLLT4 (NM_001040000) in HEK293T cells paraffin embedded controls for ICC/IHC staining

l Afadin (AFDN) ICC Control Block
TB435333

USD 2,480.00

4 Weeks

Transient overexpression of MLLT4 (NM_001207008) in HEK293T cells paraffin embedded controls for ICC/IHC staining

l Afadin (AFDN) ICC Control Block
TB440207

USD 2,520.00

4 Weeks

Transient overexpression of MLLT4 (NM_001291964) in HEK293T cells paraffin embedded controls for ICC/IHC staining

l Afadin (AFDN) Cytosection
TS417774

USD 225.00

4 Weeks

Transient overexpression of MLLT4 (NM_001040000) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

l Afadin (AFDN) Cytosection
TS417774P5

USD 889.00

4 Weeks

Transient overexpression of MLLT4 (NM_001040000) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

l Afadin (AFDN) ICC Control Sections
TS435333P5

USD 889.00

4 Weeks

Transient overexpression of MLLT4 (NM_001207008) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

l Afadin (AFDN) ICC Control Sections
TS440207P5

USD 889.00

4 Weeks

Transient overexpression of MLLT4 (NM_001291964) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack