Products

Proteins (9)
cDNA Clones (7)
Antibodies (1)
Jump to Filters
View as table Download
fast skeletal Myosin (MYLPF) (NM_013292) Human Tagged ORF Clone
RG203081

USD 460.00

In Stock

MYLPF (GFP-tagged) - Human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
fast skeletal Myosin (MYLPF) (NM_013292) Human Tagged ORF Clone Lentiviral Particle
RC203081L3V

USD 820.00

6 Weeks

Lenti ORF particles, MYLPF (Myc-DDK tagged) - Human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
fast skeletal Myosin (MYLPF) (NM_013292) Human Tagged ORF Clone Lentiviral Particle
RC203081L4V

USD 820.00

6 Weeks

Lenti ORF particles, MYLPF (mGFP-tagged) - Human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
fast skeletal Myosin (MYLPF) (NM_013292) Human Over-expression Lysate
LY402240

USD 396.00

In Stock

Transient overexpression lysate of myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
fast skeletal Myosin (MYLPF) (NM_013292) Human Untagged Clone
SC122791

USD 310.00

In Stock

MYLPF (untagged)-Human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
fast skeletal Myosin (MYLPF) Rabbit Polyclonal Antibody
TA331214

USD 375.00

5 Days

Rabbit Polyclonal Anti-MYLPF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MYLPF antibody is: synthetic peptide directed towards the C-terminal region of Human MYLPF. Synthetic peptide located within the following region: LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
MYLPF (1-169, His-tag) Human Protein
AR39037PU-L

USD 1,105.00

2 Weeks

MYLPF (1-169, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
MYLPF (1-169, His-tag) Human Protein
AR39037PU-N

USD 415.00

2 Weeks

MYLPF (1-169, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
fast skeletal Myosin (MYLPF) (NM_013292) Human Over-expression Lysate
LC402240

USD 121.00

2 Weeks

MYLPF HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
fast skeletal Myosin (MYLPF) (NM_013292) Human Mass Spec Standard
PH303081

USD 2,055.00

3 Weeks

MYLPF MS Standard C13 and N15-labeled recombinant protein (NP_037424)

Tag C-Myc/DDK
Expression Host HEK293
fast skeletal Myosin (MYLPF) (NM_013292) ICC Control Block
TB403081

USD 1,040.00

4 Weeks

Transient overexpression of MYLPF (NM_013292) in HEK293T cells paraffin embedded controls for ICC/IHC staining

fast skeletal Myosin (MYLPF) Cytosection
TS403081

USD 225.00

4 Weeks

Transient overexpression of MYLPF (NM_013292) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

fast skeletal Myosin (MYLPF) Cytosection
TS403081P5

USD 889.00

4 Weeks

Transient overexpression of MYLPF (NM_013292) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack