USD 98.00
USD 390.00
In Stock
MYLPF (Myc-DDK-tagged)-Human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 98.00
USD 390.00
In Stock
MYLPF (Myc-DDK-tagged)-Human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Mylpf (Myc-DDK-tagged) - Mouse myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MYLPF (GFP-tagged) - Human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MYLPF - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Mylpf - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Mylpf (GFP-tagged) - Mouse myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Mylpf (Myc-DDK-tagged) - Mouse myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Mylpf (Myc-DDK-tagged) - Mouse myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Mylpf (mGFP-tagged) - Mouse myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Mylpf (GFP-tagged) - Mouse myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, MYLPF (Myc-DDK tagged) - Human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, MYLPF (mGFP-tagged) - Human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Mylpf (Myc-DDK-tagged ORF) - Rat myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Mylpf (Myc-DDK-tagged ORF) - Rat myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Mylpf (Myc-DDK-tagged ORF) - Rat myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Mylpf (mGFP-tagged ORF) - Rat myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Mylpf (GFP-tagged ORF) - Rat myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
MYLPF (untagged)-Human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Mylpf (untagged) - Mouse myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf), (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-MYLPF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MYLPF antibody is: synthetic peptide directed towards the C-terminal region of Human MYLPF. Synthetic peptide located within the following region: LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE |
MYLPF (1-169, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
MYLPF (1-169, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
MYLPF CRISPRa kit - CRISPR gene activation of human myosin light chain, phosphorylatable, fast skeletal muscle
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Mylpf CRISPRa kit - CRISPR gene activation of mouse myosin light chain, phosphorylatable, fast skeletal muscle
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene MYLPF
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene MYLPF
MYLPF HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Mylpf
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Mylpf
MYLPF MS Standard C13 and N15-labeled recombinant protein (NP_037424)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Mylpf (untagged ORF) - Rat myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Mylpf (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Mylpf (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
MYLPF (phospho-S16) polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic phosphopeptide derived from human MYLPF around the phosphorylation site of Serine 16. |
Transient overexpression of MYLPF (NM_013292) in HEK293T cells paraffin embedded controls for ICC/IHC staining
MYLPF - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
USD 1,395.00
5 Weeks
MYLPF - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Mylpf - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Mylpf - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Mylpf - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Mylpf - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse myosin light chain, phosphorylatable, fast skeletal muscle (Mylpf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Tag | C-MYC/DDK |
Expression Host | HEK293T |
MYLPF - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Mylpf - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Mylpf - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Transient overexpression of MYLPF (NM_013292) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack