Products

cDNA Clones (22)
Proteins (16)
Antibodies (1)
Jump to Filters
View as table Download
AASDH (NM_181806) Human Tagged ORF Clone
RC216923

USD 1,150.00

In Stock

AASDH (Myc-DDK-tagged)-Human aminoadipate-semialdehyde dehydrogenase (AASDH)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
AASDH (NM_181806) Human Tagged ORF Clone
RC216923L3

USD 1,350.00

3 Weeks

Lenti ORF clone of Human aminoadipate-semialdehyde dehydrogenase (AASDH), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AASDH (NM_181806) Human Tagged ORF Clone Lentiviral Particle
RC216923L3V

USD 1,550.00

6 Weeks

Lenti ORF particles, AASDH (Myc-DDK tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AASDH (NM_181806) Human Tagged ORF Clone
RC216923L4

USD 1,350.00

3 Weeks

Lenti ORF clone of Human aminoadipate-semialdehyde dehydrogenase (AASDH), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AASDH (NM_181806) Human Tagged ORF Clone Lentiviral Particle
RC216923L4V

USD 1,550.00

6 Weeks

Lenti ORF particles, AASDH (mGFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AASDH (NM_001286670) Human Tagged ORF Clone
RC239089

USD 480.00

3 Weeks

AASDH (myc-DDK-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_001286672) Human Tagged ORF Clone
RC239665

USD 750.00

4 Weeks

AASDH (myc-DDK-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_001286671) Human Tagged ORF Clone
RC239693

USD 750.00

4 Weeks

AASDH (myc-DDK-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_001286669) Human Tagged ORF Clone
RC239811

USD 750.00

4 Weeks

AASDH (myc-DDK-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_001286668) Human Tagged ORF Clone
RC239866

USD 750.00

4 Weeks

AASDH (myc-DDK-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_181806) Human Tagged ORF Clone
RG216923

USD 1,260.00

3 Weeks

AASDH (GFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH Rabbit Polyclonal Antibody
TA337591

USD 375.00

5 Days

Rabbit Polyclonal Anti-AASDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AASDH antibody: synthetic peptide directed towards the middle region of human AASDH. Synthetic peptide located within the following region: TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL
AASDH (NM_181806) Human Over-expression Lysate
LC405597

USD 187.00

2 Weeks

AASDH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AASDH (NM_181806) Human Over-expression Lysate
LY405597

USD 605.00

5 Days

Transient overexpression lysate of aminoadipate-semialdehyde dehydrogenase (AASDH)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AASDH (NM_181806) Human Mass Spec Standard
PH316923

USD 2,055.00

3 Weeks

AASDH MS Standard C13 and N15-labeled recombinant protein (NP_861522)

Tag C-Myc/DDK
Expression Host HEK293
AASDH (NM_001286670) Human Tagged ORF Clone
RG239089

USD 520.00

2 Weeks

AASDH (GFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_001286672) Human Tagged ORF Clone
RG239665

USD 790.00

2 Weeks

AASDH (GFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_001286671) Human Tagged ORF Clone
RG239693

USD 790.00

2 Weeks

AASDH (GFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_001286669) Human Tagged ORF Clone
RG239811

USD 790.00

2 Weeks

AASDH (GFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_001286668) Human Tagged ORF Clone
RG239866

USD 790.00

2 Weeks

AASDH (GFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_181806) Human Untagged Clone
SC309316

USD 2,240.00

3 Weeks

AASDH (untagged)-Human aminoadipate-semialdehyde dehydrogenase (AASDH)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
AASDH (NM_001286670) Human Untagged Clone
SC336983

USD 630.00

3 Weeks

AASDH (untagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
AASDH (NM_001286672) Human Untagged Clone
SC337559

USD 850.00

4 Weeks

AASDH (untagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
AASDH (NM_001286671) Human Untagged Clone
SC337587

USD 870.00

4 Weeks

AASDH (untagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
AASDH (NM_001286669) Human Untagged Clone
SC337705

USD 960.00

4 Weeks

AASDH (untagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
AASDH (NM_001286668) Human Untagged Clone
SC337760

USD 1,020.00

4 Weeks

AASDH (untagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
AASDH (NM_181806) ICC Control Block
TB416923

USD 1,800.00

4 Weeks

Transient overexpression of AASDH (NM_181806) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AASDH (NM_001286670) ICC Control Block
TB439089

USD 1,130.00

4 Weeks

Transient overexpression of AASDH (NM_001286670) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AASDH (NM_001286672) ICC Control Block
TB439665

USD 1,400.00

4 Weeks

Transient overexpression of AASDH (NM_001286672) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AASDH (NM_001286671) ICC Control Block
TB439693

USD 1,400.00

4 Weeks

Transient overexpression of AASDH (NM_001286671) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AASDH (NM_001286669) ICC Control Block
TB439811

USD 1,400.00

4 Weeks

Transient overexpression of AASDH (NM_001286669) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AASDH (NM_001286668) ICC Control Block
TB439866

USD 1,400.00

4 Weeks

Transient overexpression of AASDH (NM_001286668) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AASDH Cytosection
TS416923

USD 225.00

4 Weeks

Transient overexpression of AASDH (NM_181806) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

AASDH Cytosection
TS416923P5

USD 889.00

4 Weeks

Transient overexpression of AASDH (NM_181806) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

AASDH ICC Control Sections
TS439089P5

USD 889.00

4 Weeks

Transient overexpression of AASDH (NM_001286670) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

AASDH ICC Control Sections
TS439665P5

USD 889.00

4 Weeks

Transient overexpression of AASDH (NM_001286672) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

AASDH ICC Control Sections
TS439693P5

USD 889.00

4 Weeks

Transient overexpression of AASDH (NM_001286671) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

AASDH ICC Control Sections
TS439811P5

USD 889.00

4 Weeks

Transient overexpression of AASDH (NM_001286669) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

AASDH ICC Control Sections
TS439866P5

USD 889.00

4 Weeks

Transient overexpression of AASDH (NM_001286668) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack