Products

cDNA Clones (31)
Proteins (16)
Antibodies (1)
Jump to Filters
View as table Download
OGDH (NM_002541) Human Tagged ORF Clone
RC200446

USD 98.00

USD 800.00

In Stock

OGDH (Myc-DDK-tagged)-Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
OGDH (NM_001003941) Human Tagged ORF Clone
RC224183

USD 420.00

In Stock

OGDH (Myc-DDK-tagged)-Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
OGDH (NM_002541) Human Recombinant Protein
TP300446

USD 867.00

In Stock

Recombinant protein of human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

OGDH (NM_002541) Human Tagged ORF Clone Lentiviral Particle
RC200446L1V

USD 1,632.00

2 Weeks

Lenti ORF particles, OGDH (Myc-DDK tagged) - Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
OGDH (NM_002541) Human Tagged ORF Clone Lentiviral Particle
RC200446L2V

USD 1,632.00

5 Weeks

Lenti ORF particles, OGDH (mGFP-tagged) - Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
OGDH (NM_001003941) Human Tagged ORF Clone Lentiviral Particle
RC224183L1V

USD 820.00

3 Weeks

Lenti ORF particles, OGDH (Myc-DDK tagged) - Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
OGDH (NM_001003941) Human Tagged ORF Clone Lentiviral Particle
RC224183L2V

USD 820.00

6 Weeks

Lenti ORF particles, OGDH (mGFP-tagged) - Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
OGDH (NM_002541) Human Tagged ORF Clone
RG200446

USD 1,010.00

3 Weeks

OGDH (GFP-tagged) - Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OGDH (NM_001165036) Human Tagged ORF Clone
RC228630

USD 1,070.00

In Stock

OGDH (Myc-DDK-tagged)-Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
OGDH (NM_002541) Human Tagged Lenti ORF Clone
RC200446L3

USD 1,380.00

3 Weeks

Lenti ORF clone of Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDH (NM_002541) Human Tagged ORF Clone Lentiviral Particle
RC200446L3V

USD 1,632.00

5 Weeks

Lenti ORF particles, OGDH (Myc-DDK tagged) - Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDH (NM_002541) Human Tagged Lenti ORF Clone
RC200446L4

USD 1,380.00

In Stock

Lenti ORF clone of Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDH (NM_002541) Human Tagged ORF Clone Lentiviral Particle
RC200446L4V

USD 1,632.00

2 Weeks

Lenti ORF particles, OGDH (mGFP-tagged) - Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDH (NM_001003941) Human Tagged ORF Clone
RC224183L3

USD 620.00

3 Weeks

Lenti ORF clone of Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDH (NM_001003941) Human Tagged ORF Clone Lentiviral Particle
RC224183L3V

USD 820.00

7 Weeks

Lenti ORF particles, OGDH (Myc-DDK tagged) - Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDH (NM_001003941) Human Tagged ORF Clone
RC224183L4

USD 620.00

3 Weeks

Lenti ORF clone of Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDH (NM_001003941) Human Tagged ORF Clone Lentiviral Particle
RC224183L4V

USD 820.00

7 Weeks

Lenti ORF particles, OGDH (mGFP-tagged) - Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDH (NM_001165036) Human Tagged ORF Clone
RC228630L3

USD 1,270.00

3 Weeks

Lenti-ORF clone of OGDH (Myc-DDK-tagged)-Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDH (NM_001165036) Human Tagged ORF Clone Lentiviral Particle
RC228630L3V

USD 1,470.00

6 Weeks

Lenti ORF particles, OGDH (Myc-DDK-tagged)-Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDH (NM_001165036) Human Tagged ORF Clone
RC228630L4

USD 1,270.00

3 Weeks

Lenti-ORF clone of OGDH (mGFP-tagged)-Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDH (NM_001165036) Human Tagged ORF Clone Lentiviral Particle
RC228630L4V

USD 1,470.00

6 Weeks

Lenti ORF particles, OGDH (mGFP-tagged)-Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDH (NM_001003941) Human Tagged ORF Clone
RG224183

USD 460.00

3 Weeks

OGDH (GFP-tagged) - Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OGDH (NM_001165036) Human Tagged ORF Clone
RG228630

USD 1,180.00

3 Weeks

OGDH (GFP-tagged) - Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OGDH (NM_002541) Human Tagged Lenti ORF Clone
RC200446L1

USD 1,380.00

In Stock

Lenti ORF clone of Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
OGDH (NM_001003941) Human Tagged ORF Clone
RC224183L1

USD 620.00

In Stock

Lenti ORF clone of Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
OGDH (NM_002541) Human Untagged Clone
SC127702

USD 310.00

In Stock

OGDH (untagged)-Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
OGDH (NM_002541) Human Untagged Clone
SC324589

USD 310.00

In Stock

OGDH (untagged)-Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
OGDH Rabbit Polyclonal Antibody
TA344249

USD 475.00

5 Days

Rabbit Polyclonal Anti-OGDH Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OGDH antibody: synthetic peptide directed towards the N terminal of human OGDH. Synthetic peptide located within the following region: MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL
OGDH (NM_002541) Human Tagged Lenti ORF Clone
RC200446L2

USD 1,380.00

3 Weeks

Lenti ORF clone of Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
OGDH (NM_001003941) Human Tagged ORF Clone
RC224183L2

USD 620.00

3 Weeks

Lenti ORF clone of Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
OGDH (BC009580) Human Untagged Clone
SC123700

USD 660.00

In Stock

OGDH (untagged)-Homo sapiens, Similar to oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide), clone MGC:14605 IMAGE:4046929, complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
OGDH (NM_001003941) Human Recombinant Protein
TP760691

USD 215.00

In Stock

Purified recombinant protein of Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
OGDH (NM_002541) Human Over-expression Lysate
LC419245

USD 121.00

2 Weeks

OGDH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OGDH (NM_001003941) Human Over-expression Lysate
LC424041

USD 187.00

2 Weeks

OGDH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OGDH (NM_002541) Human Over-expression Lysate
LY419245

USD 396.00

5 Days

Transient overexpression lysate of oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OGDH (NM_001003941) Human Over-expression Lysate
LY424041

USD 605.00

5 Days

Transient overexpression lysate of oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OGDH (NM_002541) Human Mass Spec Standard
PH300446

USD 2,055.00

3 Weeks

OGDH MS Standard C13 and N15-labeled recombinant protein (NP_002532)

Tag C-Myc/DDK
Expression Host HEK293
OGDH (NM_001003941) Human Untagged Clone
SC300581

USD 720.00

3 Weeks

OGDH (untagged)-Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
OGDH (NM_001165036) Human Untagged Clone
SC327265

USD 2,080.00

6 Weeks

OGDH (untagged)-Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH) nuclear gene encoding mitochondrial protein transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
OGDH ICC Control Block
TB400446

USD 1,450.00

4 Weeks

Transient overexpression of OGDH (NM_002541) in HEK293T cells paraffin embedded controls for ICC/IHC staining

OGDH ICC Control Block
TB424183

USD 1,070.00

4 Weeks

Transient overexpression of OGDH (NM_001003941) in HEK293T cells paraffin embedded controls for ICC/IHC staining

OGDH ICC Control Block
TB428630

USD 1,720.00

4 Weeks

Transient overexpression of OGDH (NM_001165036) in HEK293T cells paraffin embedded controls for ICC/IHC staining

OGDH Cytosection
TS400446

USD 225.00

4 Weeks

Transient overexpression of OGDH (NM_002541) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

OGDH Cytosection
TS400446P5

USD 889.00

4 Weeks

Transient overexpression of OGDH (NM_002541) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

OGDH Cytosection
TS424183

USD 225.00

4 Weeks

Transient overexpression of OGDH (NM_001003941) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

OGDH Cytosection
TS424183P5

USD 889.00

4 Weeks

Transient overexpression of OGDH (NM_001003941) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

OGDH Cytosection
TS428630

USD 225.00

4 Weeks

Transient overexpression of OGDH (NM_001165036) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

OGDH Cytosection
TS428630P5

USD 889.00

4 Weeks

Transient overexpression of OGDH (NM_001165036) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack