Products

cDNA Clones (21)
Proteins (10)
Antibodies (5)
Jump to Filters
View as table Download
AP1B1 (NM_001127) Human Tagged ORF Clone
RC211920

USD 750.00

In Stock

AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
AP1B1 (NM_001127) Human Tagged ORF Clone
RC211920L3

USD 950.00

3 Weeks

Lenti ORF clone of Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001127) Human Tagged ORF Clone Lentiviral Particle
RC211920L3V

USD 1,150.00

6 Weeks

Lenti ORF particles, AP1B1 (Myc-DDK tagged) - Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001127) Human Tagged ORF Clone
RC211920L4

USD 950.00

3 Weeks

Lenti ORF clone of Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001127) Human Tagged ORF Clone Lentiviral Particle
RC211920L4V

USD 1,150.00

6 Weeks

Lenti ORF particles, AP1B1 (mGFP-tagged) - Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_145730) Human Tagged ORF Clone
RC212913

USD 750.00

5 Weeks

AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AP1B1 (NM_145730) Human Tagged ORF Clone
RC212913L3

USD 950.00

5 Weeks

Lenti-ORF clone of AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_145730) Human Tagged ORF Clone Lentiviral Particle
RC212913L3V

USD 1,150.00

8 Weeks

Lenti ORF particles, AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_145730) Human Tagged ORF Clone
RC212913L4

USD 950.00

5 Weeks

Lenti-ORF clone of AP1B1 (mGFP-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_145730) Human Tagged ORF Clone Lentiviral Particle
RC212913L4V

USD 1,150.00

8 Weeks

Lenti ORF particles, AP1B1 (mGFP-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001166019) Human Tagged ORF Clone
RC229039

USD 750.00

5 Weeks

AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AP1B1 (NM_001166019) Human Tagged ORF Clone
RC229039L3

USD 950.00

5 Weeks

Lenti-ORF clone of AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001166019) Human Tagged ORF Clone Lentiviral Particle
RC229039L3V

USD 1,150.00

8 Weeks

Lenti ORF particles, AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001166019) Human Tagged ORF Clone
RC229039L4

USD 950.00

5 Weeks

Lenti-ORF clone of AP1B1 (mGFP-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001166019) Human Tagged ORF Clone Lentiviral Particle
RC229039L4V

USD 1,150.00

8 Weeks

Lenti ORF particles, AP1B1 (mGFP-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001127) Human Tagged ORF Clone
RG211920

USD 830.00

3 Weeks

AP1B1 (GFP-tagged) - Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AP1B1 (NM_145730) Human Tagged ORF Clone
RG212913

USD 830.00

5 Weeks

AP1B1 (GFP-tagged) - Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AP1B1 (NM_001166019) Human Tagged ORF Clone
RG229039

USD 830.00

5 Weeks

AP1B1 (GFP-tagged) - Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AP1B1 (NM_001166019) Human Untagged Clone
SC327674

USD 760.00

In Stock

AP1B1 (untagged)-Human adaptor-related protein complex 1 beta 1 subunit (AP1B1) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
AP1B1 (NM_001127) Human Over-expression Lysate
LC420112

USD 187.00

In Stock

AP1B1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AP1B1 Rabbit Polyclonal Antibody
TA308828

USD 415.00

5 Days

Rabbit polyclonal antibody to beta-Adaptin (adaptor-related protein complex 1, beta 1 subunit)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 384 and 609 of beta-Adaptin (Uniprot ID#Q10567)
AP1B1 Rabbit Polyclonal Antibody
TA342804

USD 375.00

5 Days

Rabbit Polyclonal Anti-AP1B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP1B1 antibody: synthetic peptide directed towards the C terminal of human AP1B1. Synthetic peptide located within the following region: KLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKE
AP1B1 (NM_001127) Human Mass Spec Standard
PH311920

USD 2,055.00

3 Weeks

AP1B1 MS Standard C13 and N15-labeled recombinant protein (NP_001118)

Tag C-Myc/DDK
Expression Host HEK293
AP1B1 (NM_001127) Human Untagged Clone
SC310033

USD 1,930.00

3 Weeks

AP1B1 (untagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
AP1B1 (NM_145730) Human Untagged Clone
SC310036

USD 1,910.00

5 Weeks

AP1B1 (untagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
SC310036 is the updated version of SC108226.
AP1B1 Rabbit Polyclonal Antibody
TA323221

USD 345.00

In Stock

Anti-AP1B1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-30 amino acids of Human Adapter-related protein complex 1 subunit beta-1
AP1B1 Rabbit Polyclonal Antibody
TA323222

USD 345.00

In Stock

Anti-AP1B1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-30 amino acids of Human Adapter-related protein complex 1 subunit beta-1
AP1B1 Rabbit Polyclonal Antibody
TA350855

USD 345.00

In Stock

Rabbit Polyclonal Anti-AP1B1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human AP1B1
AP1B1 ICC Control Block
TB411920

USD 1,400.00

4 Weeks

Transient overexpression of AP1B1 (NM_001127) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AP1B1 ICC Control Block
TB412913

USD 1,400.00

4 Weeks

Transient overexpression of AP1B1 (NM_145730) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AP1B1 ICC Control Block
TB429039

USD 1,400.00

4 Weeks

Transient overexpression of AP1B1 (NM_001166019) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AP1B1 Cytosection
TS411920

USD 225.00

4 Weeks

Transient overexpression of AP1B1 (NM_001127) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

AP1B1 Cytosection
TS411920P5

USD 889.00

4 Weeks

Transient overexpression of AP1B1 (NM_001127) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

AP1B1 ICC Control Sections
TS412913P5

USD 889.00

4 Weeks

Transient overexpression of AP1B1 (NM_145730) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

AP1B1 ICC Control Sections
TS429039P5

USD 889.00

4 Weeks

Transient overexpression of AP1B1 (NM_001166019) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack