Products

cDNA Clones (41)
RNAi (12)
Proteins (11)
Antibodies (8)
Gene Expression (7)
Jump to Filters
View as table Download
AP1B1 (NM_001127) Human Tagged ORF Clone
RC211920

USD 750.00

In Stock

AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Ap1b1 (NM_007454) Mouse Tagged ORF Clone
MR211270

USD 750.00

In Stock

Ap1b1 (Myc-DDK-tagged) - Mouse adaptor protein complex AP-1, beta 1 subunit (Ap1b1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AP1B1 Human Gene Knockout Kit (CRISPR)
KN411920

USD 1,290.00

2 Weeks

AP1B1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN411920 is the updated version of KN211920.
Ap1b1 Mouse Gene Knockout Kit (CRISPR)
KN501351

USD 1,290.00

2 Weeks

Ap1b1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN501351 is the updated version of KN301351.
Ap1b1 (NM_007454) Mouse Tagged ORF Clone
MG211270

USD 830.00

3 Weeks

Ap1b1 (GFP-tagged) - Mouse adaptor protein complex AP-1, beta 1 subunit (Ap1b1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ap1b1 (NM_007454) Mouse Tagged ORF Clone
MR211270L3

USD 950.00

3 Weeks

Lenti ORF clone of Ap1b1 (Myc-DDK-tagged) - Mouse adaptor protein complex AP-1, beta 1 subunit (Ap1b1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ap1b1 (NM_007454) Mouse Tagged ORF Clone Lentiviral Particle
MR211270L3V

USD 1,150.00

6 Weeks

Lenti ORF particles, Ap1b1 (Myc-DDK-tagged) - Mouse adaptor protein complex AP-1, beta 1 subunit (Ap1b1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ap1b1 (NM_007454) Mouse Tagged ORF Clone
MR211270L4

USD 950.00

3 Weeks

Lenti ORF clone of Ap1b1 (mGFP-tagged) - Mouse adaptor protein complex AP-1, beta 1 subunit (Ap1b1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ap1b1 (NM_007454) Mouse Tagged ORF Clone Lentiviral Particle
MR211270L4V

USD 1,150.00

6 Weeks

Lenti ORF particles, Ap1b1 (GFP-tagged) - Mouse adaptor protein complex AP-1, beta 1 subunit (Ap1b1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ap1b1 (NM_001243044) Mouse Tagged ORF Clone
MR231413

USD 990.00

3 Weeks

Ap1b1 (myc-DDK-tagged) - Mouse adaptor protein complex AP-1, beta 1 subunit (Ap1b1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ap1b1 (NM_001243043) Mouse Tagged ORF Clone
MR231424

USD 1,000.00

5 Weeks

Ap1b1 (myc-DDK-tagged) - Mouse adaptor protein complex AP-1, beta 1 subunit (Ap1b1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AP1B1 (NM_001127) Human Tagged ORF Clone
RC211920L3

USD 950.00

3 Weeks

Lenti ORF clone of Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001127) Human Tagged ORF Clone Lentiviral Particle
RC211920L3V

USD 1,150.00

6 Weeks

Lenti ORF particles, AP1B1 (Myc-DDK tagged) - Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001127) Human Tagged ORF Clone
RC211920L4

USD 950.00

3 Weeks

Lenti ORF clone of Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001127) Human Tagged ORF Clone Lentiviral Particle
RC211920L4V

USD 1,150.00

6 Weeks

Lenti ORF particles, AP1B1 (mGFP-tagged) - Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_145730) Human Tagged ORF Clone
RC212913

USD 750.00

5 Weeks

AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AP1B1 (NM_145730) Human Tagged ORF Clone
RC212913L3

USD 950.00

5 Weeks

Lenti-ORF clone of AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_145730) Human Tagged ORF Clone Lentiviral Particle
RC212913L3V

USD 1,150.00

8 Weeks

Lenti ORF particles, AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_145730) Human Tagged ORF Clone
RC212913L4

USD 950.00

5 Weeks

Lenti-ORF clone of AP1B1 (mGFP-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_145730) Human Tagged ORF Clone Lentiviral Particle
RC212913L4V

USD 1,150.00

8 Weeks

Lenti ORF particles, AP1B1 (mGFP-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001166019) Human Tagged ORF Clone
RC229039

USD 750.00

5 Weeks

AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AP1B1 (NM_001166019) Human Tagged ORF Clone
RC229039L3

USD 950.00

5 Weeks

Lenti-ORF clone of AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001166019) Human Tagged ORF Clone Lentiviral Particle
RC229039L3V

USD 1,150.00

8 Weeks

Lenti ORF particles, AP1B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001166019) Human Tagged ORF Clone
RC229039L4

USD 950.00

5 Weeks

Lenti-ORF clone of AP1B1 (mGFP-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001166019) Human Tagged ORF Clone Lentiviral Particle
RC229039L4V

USD 1,150.00

8 Weeks

Lenti ORF particles, AP1B1 (mGFP-tagged)-Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AP1B1 (NM_001127) Human Tagged ORF Clone
RG211920

USD 830.00

3 Weeks

AP1B1 (GFP-tagged) - Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AP1B1 (NM_145730) Human Tagged ORF Clone
RG212913

USD 830.00

5 Weeks

AP1B1 (GFP-tagged) - Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AP1B1 (NM_001166019) Human Tagged ORF Clone
RG229039

USD 830.00

5 Weeks

AP1B1 (GFP-tagged) - Human adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ap1b1 (NM_017277) Rat Tagged ORF Clone
RR210374

USD 1,280.00

6 Weeks

Ap1b1 (Myc-DDK-tagged ORF) - Rat adaptor-related protein complex 1, beta 1 subunit (Ap1b1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ap1b1 (NM_017277) Rat Tagged ORF Clone
RR210374L3

USD 1,460.00

11 Weeks

Lenti ORF clone of Ap1b1 (Myc-DDK-tagged ORF) - Rat adaptor-related protein complex 1, beta 1 subunit (Ap1b1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ap1b1 (NM_017277) Rat Tagged ORF Clone Lentiviral Particle
RR210374L3V

USD 1,680.00

15 Weeks

Lenti ORF particles, Ap1b1 (Myc-DDK-tagged ORF) - Rat adaptor-related protein complex 1, beta 1 subunit (Ap1b1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ap1b1 (NM_017277) Rat Tagged ORF Clone
RR210374L4

USD 1,610.00

11 Weeks

Lenti ORF clone of Ap1b1 (mGFP-tagged ORF) - Rat adaptor-related protein complex 1, beta 1 subunit (Ap1b1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ap1b1 (NM_017277) Rat Tagged ORF Clone Lentiviral Particle
RR210374L4V

USD 1,860.00

15 Weeks

Lenti ORF particles, Ap1b1 (GFP-tagged ORF) - Rat adaptor-related protein complex 1, beta 1 subunit (Ap1b1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ap1b1 (NM_007454) Mouse Untagged Clone
MC200521

USD 210.00

In Stock

Ap1b1 (untagged) - Mouse adaptor protein complex AP-1, beta 1 subunit (Ap1b1), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
AP1B1 (NM_001166019) Human Untagged Clone
SC327674

USD 760.00

In Stock

AP1B1 (untagged)-Human adaptor-related protein complex 1 beta 1 subunit (AP1B1) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
AP1B1 (NM_001127) Human Over-expression Lysate
LC420112

USD 187.00

In Stock

AP1B1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AP1B1 Rabbit Polyclonal Antibody
TA308828

USD 415.00

5 Days

Rabbit polyclonal antibody to beta-Adaptin (adaptor-related protein complex 1, beta 1 subunit)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 384 and 609 of beta-Adaptin (Uniprot ID#Q10567)
AP1B1 Rabbit Polyclonal Antibody
TA342804

USD 375.00

5 Days

Rabbit Polyclonal Anti-AP1B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP1B1 antibody: synthetic peptide directed towards the C terminal of human AP1B1. Synthetic peptide located within the following region: KLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKE
Human AP1B1 activation kit by CRISPRa
GA100115

USD 1,290.00

2 Weeks

AP1B1 CRISPRa kit - CRISPR gene activation of human adaptor related protein complex 1 subunit beta 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Ap1b1 activation kit by CRISPRa
GA200203

USD 1,290.00

2 Weeks

Ap1b1 CRISPRa kit - CRISPR gene activation of mouse adaptor protein complex AP-1, beta 1 subunit

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
AP1B1 Human qPCR Primer Pair (NM_001127)
HP205071

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene AP1B1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
AP1B1 (NM_001127) Human Over-expression Lysate
LY420112

USD 605.00

5 Days

Transient overexpression lysate of adaptor-related protein complex 1, beta 1 subunit (AP1B1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Ap1b1 (NM_001243044) Mouse Untagged Clone
MC229202

USD 960.00

4 Weeks

Ap1b1 (untagged) - Mouse adaptor protein complex AP-1, beta 1 subunit (Ap1b1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Ap1b1 (NM_001243043) Mouse Untagged Clone
MC229213

USD 970.00

4 Weeks

Ap1b1 (untagged) - Mouse adaptor protein complex AP-1, beta 1 subunit (Ap1b1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Ap1b1 Mouse qPCR Template Standard (NM_007454)
MK200337

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Ap1b1

Application Plasmid of exact quantity for transcript copy number calculation
Ap1b1 Mouse qPCR Primer Pair (NM_007454)
MP200331

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Ap1b1

AP1B1 (NM_001127) Human Mass Spec Standard
PH311920

USD 2,055.00

3 Weeks

AP1B1 MS Standard C13 and N15-labeled recombinant protein (NP_001118)

Tag C-Myc/DDK
Expression Host HEK293
Ap1b1 (NM_017277) Rat Untagged Clone
RN210374

USD 1,280.00

6 Weeks

Ap1b1 (untagged ORF) - Rat adaptor-related protein complex 1, beta 1 subunit (Ap1b1), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
AP1B1 (NM_001166019) Human 3' UTR Clone
SC212819

USD 560.00

4 Weeks

3`UTR clone of adaptor-related protein complex 1 beta 1 subunit (AP1B1) transcript variant 3 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
AP1B1 (NM_001127) Human 3' UTR Clone
SC212820

USD 560.00

4 Weeks

3`UTR clone of adaptor-related protein complex 1 beta 1 subunit (AP1B1) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase