Products

cDNA Clones (17)
Proteins (14)
Antibodies (5)
Jump to Filters
View as table Download
gamma Adaptin (AP1G1) (NM_001128) Human Tagged ORF Clone
RC216694

USD 910.00

In Stock

AP1G1 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
gamma Adaptin (AP1G1) (NM_001128) Human Tagged ORF Clone
RG216694

USD 1,000.00

In Stock

AP1G1 (GFP-tagged) - Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
gamma Adaptin (AP1G1) (NM_001030007) Human Tagged ORF Clone
RC203954L3

USD 620.00

3 Weeks

Lenti ORF clone of Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
gamma Adaptin (AP1G1) (NM_001030007) Human Tagged ORF Clone Lentiviral Particle
RC203954L3V

USD 820.00

6 Weeks

Lenti ORF particles, AP1G1 (Myc-DDK tagged) - Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
gamma Adaptin (AP1G1) (NM_001030007) Human Tagged ORF Clone
RC203954L4

USD 620.00

3 Weeks

Lenti ORF clone of Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
gamma Adaptin (AP1G1) (NM_001030007) Human Tagged ORF Clone Lentiviral Particle
RC203954L4V

USD 820.00

6 Weeks

Lenti ORF particles, AP1G1 (mGFP-tagged) - Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
gamma Adaptin (AP1G1) (NM_001128) Human Tagged ORF Clone
RC216694L3

USD 1,110.00

3 Weeks

Lenti ORF clone of Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
gamma Adaptin (AP1G1) (NM_001128) Human Tagged ORF Clone Lentiviral Particle
RC216694L3V

USD 1,310.00

6 Weeks

Lenti ORF particles, AP1G1 (Myc-DDK tagged) - Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
gamma Adaptin (AP1G1) (NM_001128) Human Tagged ORF Clone Lentiviral Particle
RC216694L4V

USD 1,310.00

6 Weeks

Lenti ORF particles, AP1G1 (mGFP-tagged) - Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
gamma Adaptin (AP1G1) (NM_001030007) Human Tagged ORF Clone
RG203954

USD 460.00

3 Weeks

AP1G1 (GFP-tagged) - Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
gamma Adaptin (AP1G1) (NM_001030007) Human Over-expression Lysate
LY422287

USD 396.00

In Stock

Transient overexpression lysate of adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
gamma Adaptin (AP1G1) (NM_001030007) Human Tagged ORF Clone
RC203954L1

USD 620.00

3 Weeks

Lenti ORF clone of Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
gamma Adaptin (AP1G1) (NM_001030007) Human Tagged ORF Clone
RC203954L2

USD 620.00

3 Weeks

Lenti ORF clone of Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
gamma Adaptin (AP1G1) (NM_001030007) Human Over-expression Lysate
LC422287

USD 121.00

In Stock

AP1G1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
gamma Adaptin (AP1G1) (NM_001128) Human Untagged Clone
SC119413

USD 1,660.00

In Stock

AP1G1 (untagged)-Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
gamma Adaptin (AP1G1) (NM_001030007) Human Untagged Clone
SC324581

USD 760.00

In Stock

AP1G1 (untagged)-Human adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
gamma Adaptin (AP1G1) Mouse Monoclonal Antibody [Clone ID: IMD-113]
AM20688PU-N

USD 405.00

2 Weeks

gamma Adaptin (AP1G1) mouse monoclonal antibody, clone IMD-113, Purified

Applications WB
Reactivities Human, Rat
gamma Adaptin (AP1G1) Goat Polyclonal Antibody
TA319330

USD 530.00

5 Days

Goat polyclonal anti-AP1G1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 646-659 of Human AP1G1.
gamma Adaptin (AP1G1) Rabbit Polyclonal Antibody
TA339998

USD 375.00

5 Days

Rabbit Polyclonal Anti-AP1G1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP1G1 antibody: synthetic peptide directed towards the C terminal of human AP1G1. Synthetic peptide located within the following region: DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS
gamma Adaptin (AP1G1) (NM_001128) Human Over-expression Lysate
LC420113

USD 121.00

2 Weeks

AP1G1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
gamma Adaptin (AP1G1) (NM_001128) Human Over-expression Lysate
LC426886

USD 187.00

2 Weeks

AP1G1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
gamma Adaptin (AP1G1) (NM_001128) Human Over-expression Lysate
LY420113

USD 396.00

5 Days

Transient overexpression lysate of adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY420113 is the same product as LY426886.
gamma Adaptin (AP1G1) (NM_001128) Human Over-expression Lysate
LY426886

USD 605.00

5 Days

Transient overexpression lysate of adaptor-related protein complex 1, gamma 1 subunit (AP1G1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
gamma Adaptin (AP1G1) (NM_001030007) Human Mass Spec Standard
PH303954

USD 2,055.00

3 Weeks

AP1G1 MS Standard C13 and N15-labeled recombinant protein (NP_001025178)

Tag C-Myc/DDK
Expression Host HEK293
gamma Adaptin (AP1G1) Rabbit Polyclonal Antibody
TA323223

USD 345.00

4 Weeks

Anti-AP1G1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 801-813 amino acids of Human adaptor-related protein complex 1, gamma 1 subunit
gamma Adaptin (AP1G1) Rabbit Polyclonal Antibody
TA323388

USD 345.00

In Stock

Anti-AP1G1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 802-814 amino acids of Human Adapter-related protein complex 1 subunit gamma-1
gamma Adaptin (AP1G1) ICC Control Block
TB403954

USD 1,070.00

4 Weeks

Transient overexpression of AP1G1 (NM_001030007) in HEK293T cells paraffin embedded controls for ICC/IHC staining

gamma Adaptin (AP1G1) ICC Control Block
TB416694

USD 1,560.00

4 Weeks

Transient overexpression of AP1G1 (NM_001128) in HEK293T cells paraffin embedded controls for ICC/IHC staining

gamma Adaptin (AP1G1) Cytosection
TS403954

USD 225.00

4 Weeks

Transient overexpression of AP1G1 (NM_001030007) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

gamma Adaptin (AP1G1) Cytosection
TS403954P5

USD 889.00

4 Weeks

Transient overexpression of AP1G1 (NM_001030007) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

gamma Adaptin (AP1G1) Cytosection
TS416694

USD 225.00

4 Weeks

Transient overexpression of AP1G1 (NM_001128) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

gamma Adaptin (AP1G1) Cytosection
TS416694P5

USD 889.00

4 Weeks

Transient overexpression of AP1G1 (NM_001128) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack