Products

cDNA Clones (19)
Proteins (17)
Antibodies (3)
Jump to Filters
View as table Download
Legumain (LGMN) (NM_001008530) Human Tagged ORF Clone
RC200309

USD 98.00

USD 560.00

In Stock

LGMN (Myc-DDK-tagged)-Human legumain (LGMN), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Legumain (LGMN) (NM_005606) Human Tagged ORF Clone
RG224975

USD 460.00

In Stock

LGMN (GFP-tagged) - Human legumain (LGMN), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Legumain (LGMN) (NM_001008530) Human Tagged ORF Clone
RG200309

USD 460.00

In Stock

LGMN (GFP-tagged) - Human legumain (LGMN), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Legumain (LGMN) (NM_005606) Human Tagged ORF Clone
RC224975L3

USD 620.00

3 Weeks

Lenti ORF clone of Human legumain (LGMN), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Legumain (LGMN) (NM_005606) Human Tagged ORF Clone
RC224975L4

USD 620.00

3 Weeks

Lenti ORF clone of Human legumain (LGMN), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Legumain (LGMN) (NM_005606) Human Untagged Clone
SC116627

USD 310.00

In Stock

LGMN (untagged)-Human legumain (LGMN), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Legumain (LGMN) (NM_001008530) Human Untagged Clone
SC320658

USD 760.00

In Stock

LGMN (untagged)-Human legumain (LGMN), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Legumain (LGMN) (NM_005606) Human Tagged ORF Clone
RC224975L1

USD 620.00

In Stock

Lenti ORF clone of Human legumain (LGMN), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Legumain (LGMN) (NM_005606) Human Tagged ORF Clone
RC224975L2

USD 620.00

3 Weeks

Lenti ORF clone of Human legumain (LGMN), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Legumain (LGMN) Rabbit Polyclonal Antibody
TA354520

USD 355.00

5 Days

Rabbit anti Legumain Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence (a portion from 100aa-190aa) of human Legumain protein. This sequence is identical to mouse, human and rat.
Legumain (LGMN) (NM_001008530) Human Over-expression Lysate
LY400393

USD 396.00

5 Days

Transient overexpression lysate of legumain (LGMN), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Legumain (LGMN) Rabbit Polyclonal Antibody
TA331334

USD 375.00

5 Days

Rabbit Polyclonal Anti-LGMN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: KMVFYIEACESGSMMNHLPDNINVYATTAANPRESSYACYYDEKRSTYLG
Legumain (LGMN) Rabbit Polyclonal Antibody
TA331335

USD 375.00

5 Days

Rabbit Polyclonal Anti-LGMN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTN
Legumain (LGMN) (NM_001008530) Human Over-expression Lysate
LC400393

USD 121.00

2 Weeks

LGMN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Legumain (LGMN) (NM_005606) Human Over-expression Lysate
LC417185

USD 121.00

2 Weeks

LGMN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Legumain (LGMN) (NM_005606) Human Over-expression Lysate
LC429258

USD 121.00

2 Weeks

LGMN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Legumain (LGMN) (NM_005606) Human Over-expression Lysate
LY417185

USD 396.00

5 Days

Transient overexpression lysate of legumain (LGMN), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY417185 is the same product as LY429258.
Legumain (LGMN) (NM_005606) Human Over-expression Lysate
LY429258

USD 396.00

5 Days

Transient overexpression lysate of legumain (LGMN), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Legumain (LGMN) (NM_005606) Human Mass Spec Standard
PH324975

USD 2,055.00

3 Weeks

LGMN MS Standard C13 and N15-labeled recombinant protein (NP_005597)

Tag C-Myc/DDK
Expression Host HEK293
Legumain (LGMN) (NM_001008530) Human Untagged Clone
SC301315

USD 760.00

4 Weeks

LGMN (untagged)-Human legumain (LGMN), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Legumain (LGMN) ICC Control Block
TB400309

USD 1,210.00

4 Weeks

Transient overexpression of LGMN (NM_001008530) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Legumain (LGMN) ICC Control Block
TB424975

USD 1,070.00

4 Weeks

Transient overexpression of LGMN (NM_005606) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Legumain (LGMN) (NM_001008530) Human Recombinant Protein
TP720320

USD 330.00

3 Weeks

Recombinant protein of human legumain (LGMN), transcript variant 2

Tag C-His
Expression Host HEK293
Legumain (LGMN) (NM_001008530) Human Recombinant Protein
TP720320L

USD 1,900.00

3 Weeks

Recombinant protein of human legumain (LGMN), transcript variant 2

Tag C-His
Expression Host HEK293
Legumain (LGMN) (NM_001008530) Human Recombinant Protein
TP720320M

USD 760.00

3 Weeks

Recombinant protein of human legumain (LGMN), transcript variant 2

Tag C-His
Expression Host HEK293
Legumain (LGMN) (NM_001008530) Human Recombinant Protein
TP720320XL

USD 2,800.00

3 Weeks

Recombinant protein of human legumain (LGMN), transcript variant 2

Tag C-His
Expression Host HEK293
Legumain (LGMN) Cytosection
TS400309

USD 225.00

4 Weeks

Transient overexpression of LGMN (NM_001008530) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Legumain (LGMN) Cytosection
TS400309P5

USD 889.00

4 Weeks

Transient overexpression of LGMN (NM_001008530) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Legumain (LGMN) Cytosection
TS424975

USD 225.00

4 Weeks

Transient overexpression of LGMN (NM_005606) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Legumain (LGMN) Cytosection
TS424975P5

USD 889.00

4 Weeks

Transient overexpression of LGMN (NM_005606) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack