Products

cDNA Clones (34)
Proteins (20)
RNAi (12)
Gene Expression (7)
Antibodies (4)
Assay Kits (3)
Jump to Filters
View as table Download
Legumain (LGMN) (NM_001008530) Human Tagged ORF Clone
RC200309

USD 98.00

USD 560.00

In Stock

LGMN (Myc-DDK-tagged)-Human legumain (LGMN), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Legumain (LGMN) (NM_005606) Human Tagged ORF Clone
RG224975

USD 460.00

In Stock

LGMN (GFP-tagged) - Human legumain (LGMN), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lgmn (NM_011175) Mouse Tagged ORF Clone
MR221565

USD 350.00

In Stock

Lgmn (Myc-DDK-tagged) - Mouse legumain (Lgmn)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Legumain (LGMN) (NM_001008530) Human Tagged ORF Clone
RG200309

USD 460.00

In Stock

LGMN (GFP-tagged) - Human legumain (LGMN), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lgmn Mouse Gene Knockout Kit (CRISPR)
KN509255

USD 1,290.00

2 Weeks

Lgmn - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN509255 is the updated version of KN309255.
Lgmn (NM_011175) Mouse Tagged ORF Clone
MG221565

USD 390.00

3 Weeks

Lgmn (GFP-tagged) - Mouse legumain (Lgmn), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lgmn (NM_011175) Mouse Tagged ORF Clone
MR221565L3

USD 550.00

3 Weeks

Lenti ORF clone of Lgmn (Myc-DDK-tagged) - Mouse legumain (Lgmn)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lgmn (NM_011175) Mouse Tagged ORF Clone
MR221565L4

USD 550.00

3 Weeks

Lenti ORF clone of Lgmn (mGFP-tagged) - Mouse legumain (Lgmn)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Legumain (LGMN) (NM_005606) Human Tagged ORF Clone
RC224975L3

USD 620.00

3 Weeks

Lenti ORF clone of Human legumain (LGMN), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Legumain (LGMN) (NM_005606) Human Tagged ORF Clone
RC224975L4

USD 620.00

3 Weeks

Lenti ORF clone of Human legumain (LGMN), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Lgmn (NM_022226) Rat Tagged ORF Clone
RR209725

USD 590.00

4 Weeks

Lgmn (Myc-DDK-tagged ORF) - Rat legumain (Lgmn), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Lgmn (NM_022226) Rat Tagged ORF Clone
RR209725L3

USD 790.00

8 Weeks

Lenti ORF clone of Lgmn (Myc-DDK-tagged ORF) - Rat legumain (Lgmn), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lgmn (NM_022226) Rat Tagged ORF Clone
RR209725L4

USD 870.00

8 Weeks

Lenti ORF clone of Lgmn (mGFP-tagged ORF) - Rat legumain (Lgmn), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LGMN Human siRNA Oligo Duplex (Locus ID 5641)
SR303790

USD 430.00

In Stock

LGMN (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Legumain (LGMN) (NM_005606) Human Untagged Clone
SC116627

USD 310.00

In Stock

LGMN (untagged)-Human legumain (LGMN), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Legumain (LGMN) Human shRNA Lentiviral Particle (Locus ID 5641)
TL311748V

USD 1,617.00

5 Weeks

LGMN - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Legumain (LGMN) Human shRNA Plasmid Kit (Locus ID 5641)
TL311748

USD 946.00

2 Weeks

LGMN - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol (34 ug/ml)
Mammalian Cell Selection Puromycin
Legumain (LGMN) (NM_001008530) Human Untagged Clone
SC320658

USD 760.00

In Stock

LGMN (untagged)-Human legumain (LGMN), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Legumain (LGMN) (NM_005606) Human Tagged ORF Clone
RC224975L1

USD 620.00

In Stock

Lenti ORF clone of Human legumain (LGMN), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Legumain (LGMN) (NM_005606) Human Tagged ORF Clone
RC224975L2

USD 620.00

3 Weeks

Lenti ORF clone of Human legumain (LGMN), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Lgmn (NM_022226) Rat Untagged Clone
RN209725

USD 590.00

In Stock

Lgmn (untagged ORF) - Rat legumain (Lgmn), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Legumain (LGMN) Rabbit Polyclonal Antibody
TA354520

USD 355.00

5 Days

Rabbit anti Legumain Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence (a portion from 100aa-190aa) of human Legumain protein. This sequence is identical to mouse, human and rat.
Legumain (LGMN) Rabbit Polyclonal Antibody
TA331334

USD 375.00

5 Days

Rabbit Polyclonal Anti-LGMN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: KMVFYIEACESGSMMNHLPDNINVYATTAANPRESSYACYYDEKRSTYLG
Legumain (LGMN) Rabbit Polyclonal Antibody
TA331335

USD 375.00

5 Days

Rabbit Polyclonal Anti-LGMN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTN
LGMN Human shRNA Plasmid Kit (Locus ID 5641)
TR311748

USD 715.00

2 Weeks

LGMN - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
Legumain (18-435, His-tag) Mouse Protein
AR52022PU-N

USD 1,105.00

2 Weeks

Legumain (18-435, His-tag) mouse protein, 0.25 mg

Tag His-tag
Expression Host Insect
Legumain (18-435, His-tag) Mouse Protein
AR52022PU-S

USD 330.00

2 Weeks

Legumain (18-435, His-tag) mouse protein, 50 µg

Tag His-tag
Expression Host Insect
Human Legumain (LGMN) ELISA KIT (1 x 96 wells)
EA102401

USD 430.00

3 Weeks

For quantitative detection of human Legumain(total) in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

Assay Type Sandwich ELISA kit of Quantitative Detection for Human Legumain(total)
Format 8x12 divisible strips
Reactivities Human
Mouse Lgmn ELISA KIT (1 x 96 wells)
EA102402

USD 430.00

3 Weeks

For quantitative detection of mouse Legumain(total) in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

Assay Type Sandwich ELISA kit of Quantitative Detection for Mouse Legumain(total)
Format 8x12 divisible strips
Reactivities Mouse
Rat Lgmn ELISA KIT (1 x 96 wells)
EA102777

USD 470.00

3 Weeks

For quantitative detection of rat Legumain in cell culture supernates, serum and plasma (heparin, EDTA, citrate).

Assay Type Sandwich ELISA kit of Quantitative Detection for Rat Legumain
Format 8x12 divisible strips
Reactivities Rat
Human Legumain (LGMN) activation kit by CRISPRa
GA103822

USD 1,290.00

2 Weeks

LGMN CRISPRa kit - CRISPR gene activation of human legumain

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Lgmn activation kit by CRISPRa
GA203411

USD 1,290.00

2 Weeks

Lgmn CRISPRa kit - CRISPR gene activation of mouse legumain

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Legumain (LGMN) Human qPCR Template Standard (NM_005606)
HK204328

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene LGMN

Application Plasmid of exact quantity for transcript copy number calculation
Legumain (LGMN) Human qPCR Template Standard (NM_001008530)
HK208567

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene LGMN

Application Plasmid of exact quantity for transcript copy number calculation
Legumain (LGMN) Human qPCR Primer Pair (NM_005606)
HP234384

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene LGMN

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Legumain (LGMN) (NM_001008530) Human Over-expression Lysate
LC400393

USD 121.00

2 Weeks

LGMN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T