Products

Antibodies (31)
Proteins (24)
cDNA Clones (20)
Jump to Filters
View as table Download
SCF (KITLG) (NM_003994) Human Tagged ORF Clone
RC213540

USD 98.00

USD 390.00

In Stock

KITLG (Myc-DDK-tagged)-Human KIT ligand (KITLG), transcript variant a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SCF (KITLG) (NM_000899) Human Tagged ORF Clone
RC216131

USD 420.00

In Stock

KITLG (Myc-DDK-tagged)-Human KIT ligand (KITLG), transcript variant b

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SCF (KITLG) (NM_000899) Human Recombinant Protein
TP723397

USD 240.00

5 Days

Purified recombinant protein of Human KIT ligand (KITLG), transcript variant b.

Tag Tag Free
Expression Host E. coli
SCF (KITLG) (NM_000899) Human Untagged Clone
SC119596

USD 310.00

In Stock

KITLG (untagged)-Human KIT ligand (KITLG), transcript variant b

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SCF (KITLG) (NM_003994) Human Tagged ORF Clone
RG213540

USD 460.00

In Stock

KITLG (GFP-tagged) - Human KIT ligand (KITLG), transcript variant a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SCF (KITLG) (NM_000899) Human Tagged ORF Clone
RG216131

USD 460.00

In Stock

KITLG (GFP-tagged) - Human KIT ligand (KITLG), transcript variant b

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SCF (KITLG) (NM_000899) Human Tagged ORF Clone
RC216131L3

USD 620.00

3 Weeks

Lenti ORF clone of Human KIT ligand (KITLG), transcript variant b, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SCF (KITLG) (NM_000899) Human Tagged ORF Clone
RC216131L4

USD 620.00

3 Weeks

Lenti ORF clone of Human KIT ligand (KITLG), transcript variant b, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SCF (KITLG) (NM_000899) Human Tagged ORF Clone
RC216131L1

USD 768.00

In Stock

Lenti ORF clone of Human KIT ligand (KITLG), transcript variant b, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SCF (KITLG) (NM_000899) Human Recombinant Protein
TP723730

USD 265.00

2 Weeks

Purified recombinant protein of Human KIT ligand (KITLG / SCF), transcript variant b

Tag Tag Free
Expression Host E. coli
SCF (KITLG) (NM_003994) Human Untagged Clone
SC312617

USD 420.00

In Stock

KITLG (untagged)-Human KIT ligand (KITLG), transcript variant a

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
KITLG / SCF Human Protein
DA3511X

USD 210.00

2 Weeks

KITLG / SCF human recombinant protein, 5 µg

Expression Host Insect
KITLG / SCF (His-tag) Human Protein
DA3511XC

USD 375.00

2 Weeks

KITLG / SCF (His-tag) human recombinant protein, 20 µg

Tag His-tag
Expression Host Insect
KITLG / SCF (His-tag) Human Protein
DA3511XD

USD 515.00

2 Weeks

KITLG / SCF (His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host Insect
KITLG / SCF Human Protein
DA3548

USD 240.00

2 Weeks

KITLG / SCF human recombinant protein, 10 µg

Expression Host E. coli
KITLG / SCF Human Protein
DA3548S

USD 155.00

2 Weeks

KITLG / SCF human recombinant protein, 2 µg

Expression Host E. coli
KITLG / SCF Human Protein
DA3548X

USD 415.00

2 Weeks

KITLG / SCF human recombinant protein, 50 µg

Expression Host E. coli
SCF (KITLG) (NM_003994) Human Tagged ORF Clone
RC213540L1

USD 620.00

In Stock

Lenti ORF clone of Human KIT ligand (KITLG), transcript variant a, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SCF (KITLG) Rabbit Polyclonal Antibody
TA306779

USD 430.00

2 Weeks

Rabbit Polyclonal SCF Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SCF antibody was raised against an 18 amino acid peptide from near the center of human SCF.
SCF (KITLG) Mouse Monoclonal Antibody [Clone ID: hKL12]
BM4117

USD 635.00

2 Weeks

SCF (KITLG) mouse monoclonal antibody, clone hKL12, Purified

Applications ELISA, IHC, WB
Reactivities Human, Primate
SCF (KITLG) Rabbit Polyclonal Antibody
PP1066P1

USD 250.00

2 Weeks

SCF (KITLG) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hSCF (anti-hSCF).
SCF (KITLG) Rabbit Polyclonal Antibody
PP1066P2

USD 340.00

2 Weeks

SCF (KITLG) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hSCF.
SCF (KITLG) Rabbit Polyclonal Antibody
TA347853

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-SCF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCF Antibody: Peptide sequence around aa.265~269(E-K-E-R-E) derived from Human SCF.
SCF (KITLG) Rabbit Polyclonal Antibody
AP23873PU-N

USD 440.00

2 Weeks

SCF (KITLG) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated
SCF (KITLG) Mouse Monoclonal Antibody
PM1212P

USD 220.00

2 Weeks

SCF (KITLG) mouse monoclonal antibody, Azide Free

Applications ELISA, IF, WB
Reactivities Human
SCF (KITLG) (NM_003994) Human Tagged ORF Clone
RC213540L2

USD 620.00

3 Weeks

Lenti ORF clone of Human KIT ligand (KITLG), transcript variant a, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SCF (KITLG) (NM_000899) Human Tagged ORF Clone
RC216131L2

USD 620.00

3 Weeks

Lenti ORF clone of Human KIT ligand (KITLG), transcript variant b, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SCF (KITLG) Rabbit Polyclonal Antibody
TA302195

USD 450.00

5 Days

Rabbit Polyclonal Antibody against KITLG (C-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SCF (KITLG) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 244-273 amino acids from the C-terminal region of human SCF (KITLG).
SCF (KITLG) Rabbit Polyclonal Antibody
TA328440

USD 285.00

5 Days

Anti-Human SCF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human SCF
SCF (KITLG) (NM_000899) Human Over-expression Lysate
LC400322

USD 121.00

In Stock

KITLG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
SCF (KITLG) (NM_000899) Human Over-expression Lysate
LY400322

USD 396.00

5 Days

Transient overexpression lysate of KIT ligand (KITLG), transcript variant b

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SCF (KITLG) Rabbit Polyclonal Antibody
PP1066B1

USD 250.00

2 Weeks

SCF (KITLG) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hSCF.
SCF (KITLG) Rabbit Polyclonal Antibody
PP1066B2

USD 340.00

2 Weeks

SCF (KITLG) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hSCF.
SCF (KITLG) Goat Polyclonal Antibody
TA328439

USD 285.00

5 Days

Anti-Human SCF Goat Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human SCF
SCF (KITLG) Rabbit Polyclonal Antibody
TA321226

USD 345.00

4 Weeks

Anti-KITLG Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.265~269(E-K-E-R-E) derived from Human SCF.
SCF (KITLG) Rabbit Polyclonal Antibody
TA328437

USD 285.00

5 Days

Biotinylated Anti-Human SCF Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human SCF
SCF (KITLG) Goat Polyclonal Antibody
TA328438

USD 285.00

5 Days

Biotinylated Anti-Human SCF Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human SCF
SCF (KITLG) Rabbit Polyclonal Antibody
TA335261

USD 375.00

5 Days

Rabbit Polyclonal Anti-KITLG Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG. Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
SCF (KITLG) Mouse Monoclonal Antibody [Clone ID: OTI5F6]
CF507209

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI5F6 (formerly 5F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
SCF (KITLG) Mouse Monoclonal Antibody [Clone ID: OTI6E5]
CF507211

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
SCF (KITLG) Mouse Monoclonal Antibody [Clone ID: OTI5E9]
CF507213

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)

Applications WB
Reactivities Human
Conjugation Unconjugated
SCF (KITLG) (NM_003994) Human Over-expression Lysate
LC418261

USD 121.00

2 Weeks

KITLG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB