Products

cDNA Clones (7)
Proteins (5)
Antibodies (3)
Jump to Filters
View as table Download
ACADL (NM_001608) Human Tagged ORF Clone
RC206624

USD 477.00

In Stock

ACADL (Myc-DDK-tagged)-Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ACADL (NM_001608) Human Tagged ORF Clone
RG206624

USD 460.00

3 Weeks

ACADL (GFP-tagged) - Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACADL (NM_001608) Human Tagged ORF Clone Lentiviral Particle
RC206624L3V

USD 1,020.00

3 Weeks

Lenti ORF particles, ACADL (Myc-DDK-tagged)-Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACADL (NM_001608) Human Tagged ORF Clone
RC206624L3

USD 768.00

In Stock

Lenti-ORF clone of ACADL (Myc-DDK-tagged)-Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACADL (NM_001608) Human Tagged ORF Clone Lentiviral Particle
RC206624L4V

USD 1,020.00

6 Weeks

Lenti ORF particles, ACADL (mGFP-tagged)-Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACADL (NM_001608) Human Tagged ORF Clone
RC206624L4

USD 768.00

3 Weeks

Lenti-ORF clone of ACADL (mGFP-tagged)-Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACADL (NM_001608) Human Untagged Clone
SC119148

USD 310.00

In Stock

ACADL (untagged)-Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
ACADL Rabbit Polyclonal Antibody
TA318873

USD 385.00

3 Weeks

Rabbit polyclonal anti-ACADL antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 38 of human ACADL
ACADL Rabbit Polyclonal Antibody
TA334667

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACADL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADL antibody: synthetic peptide directed towards the N terminal of human ACADL. Synthetic peptide located within the following region: MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR
ACADL Rabbit Polyclonal Antibody
TA334668

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACADL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADL antibody: synthetic peptide directed towards the middle region of human ACADL. Synthetic peptide located within the following region: LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL
ACADL (31-430, His-tag) Human Protein
AR50103PU-N

USD 1,105.00

2 Weeks

ACADL (31-430, His-tag) human protein, 0.25 mg

Tag His-tag
Expression Host E. coli
ACADL (31-430, His-tag) Human Protein
AR50103PU-S

USD 415.00

2 Weeks

ACADL (31-430, His-tag) human protein, 50 µg

Tag His-tag
Expression Host E. coli
ACADL ICC Control Block
TB406624

USD 1,070.00

4 Weeks

Transient overexpression of ACADL (NM_001608) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACADL Cytosection
TS406624

USD 225.00

4 Weeks

Transient overexpression of ACADL (NM_001608) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ACADL Cytosection
TS406624P5

USD 889.00

4 Weeks

Transient overexpression of ACADL (NM_001608) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack