Germany
Japan
United Kingdom
China
Acadl (Myc-DDK-tagged) - Mouse acyl-Coenzyme A dehydrogenase, long-chain (Acadl), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadACADL (Myc-DDK-tagged)-Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACADL - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN406624 is the updated version of KN206624.
Acadl - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500691 is the updated version of KN300691.
Acadl (GFP-tagged) - Mouse acyl-Coenzyme A dehydrogenase, long-chain (Acadl)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acadl (Myc-DDK-tagged) - Mouse acyl-Coenzyme A dehydrogenase, long-chain (Acadl), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acadl (Myc-DDK-tagged) - Mouse acyl-Coenzyme A dehydrogenase, long-chain (Acadl), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acadl (mGFP-tagged) - Mouse acyl-Coenzyme A dehydrogenase, long-chain (Acadl), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acadl (GFP-tagged) - Mouse acyl-Coenzyme A dehydrogenase, long-chain (Acadl), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACADL (GFP-tagged) - Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Acadl (Myc-DDK-tagged ORF) - Rat acyl-Coenzyme A dehydrogenase, long-chain (Acadl), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acadl (Myc-DDK-tagged ORF) - Rat acyl-Coenzyme A dehydrogenase, long-chain (Acadl), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acadl (Myc-DDK-tagged ORF) - Rat acyl-Coenzyme A dehydrogenase, long-chain (Acadl), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acadl (mGFP-tagged ORF) - Rat acyl-Coenzyme A dehydrogenase, long-chain (Acadl), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acadl (GFP-tagged ORF) - Rat acyl-Coenzyme A dehydrogenase, long-chain (Acadl), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, ACADL (Myc-DDK-tagged)-Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ACADL (Myc-DDK-tagged)-Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACADL (mGFP-tagged)-Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ACADL (mGFP-tagged)-Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
ACADL (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ACADL - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
qSTAR qPCR primer pairs against Homo sapiens gene ACADL
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
ACADL (untagged)-Human acyl-CoA dehydrogenase, long chain (ACADL), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-ACADL antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 38 of human ACADL |
Rabbit Polyclonal Anti-ACADL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACADL antibody: synthetic peptide directed towards the N terminal of human ACADL. Synthetic peptide located within the following region: MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR |
Rabbit Polyclonal Anti-ACADL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACADL antibody: synthetic peptide directed towards the middle region of human ACADL. Synthetic peptide located within the following region: LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL |
Acadl - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
ACADL (31-430, His-tag) human protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
ACADL (31-430, His-tag) human protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
ACADL CRISPRa kit - CRISPR gene activation of human acyl-CoA dehydrogenase long chain
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Acadl CRISPRa kit - CRISPR gene activation of mouse acyl-Coenzyme A dehydrogenase, long-chain
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ACADL
| Application | Plasmid of exact quantity for transcript copy number calculation |
Acadl (untagged) - Mouse acyl-Coenzyme A dehydrogenase, long-chain (Acadl), nuclear gene encoding mitochondrial protein, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Acadl
Acadl (untagged ORF) - Rat acyl-Coenzyme A dehydrogenase, long-chain (Acadl), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of acyl-Coenzyme A dehydrogenase long chain (ACADL) nuclear gene encoding mitochondrial protein for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Acadl (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Acadl (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ACADL Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse ACADL |
Transient overexpression of ACADL (NM_001608) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ACADL - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
ACADL - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Acadl - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Acadl - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Acadl - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Acadl - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
ACADL - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Acadl - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of ACADL (NM_001608) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- ACADL