Products

View as table Download

ACSL3 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ACSL3 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, ACSL3 (Myc-DDK tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ACSL3 (mGFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, ACSL3 (Myc-DDK tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ACSL3 (mGFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

ACSL3 (GFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ACSL3 (GFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ACSL3 (Myc-DDK tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ACSL3 (mGFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ACSL3 (Myc-DDK tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ACSL3 (mGFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

ACSL3 (untagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

ACSL3 (untagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

ACSL3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 527-556 amino acids from the C-terminal region of human ACSL3

ACSL3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ACSL3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ACSL3 MS Standard C13 and N15-labeled recombinant protein (NP_004448)

Tag C-Myc/DDK
Expression Host HEK293

ACSL3 MS Standard C13 and N15-labeled recombinant protein (NP_976251)

Tag C-Myc/DDK
Expression Host HEK293

USD 1,070.00

4 Weeks

Transient overexpression of ACSL3 (NM_004457) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of ACSL3 (NM_203372) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ACSL3 (NM_004457) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ACSL3 (NM_004457) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of ACSL3 (NM_203372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ACSL3 (NM_203372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack