Germany
Japan
United Kingdom
China
ACSL3 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ACSL3 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, ACSL3 (Myc-DDK tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ACSL3 (mGFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, ACSL3 (Myc-DDK tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ACSL3 (mGFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ACSL3 (GFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACSL3 (GFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACSL3 (Myc-DDK tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACSL3 (mGFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACSL3 (Myc-DDK tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACSL3 (mGFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-ACSL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI |
ACSL3 (untagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ACSL3 (untagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
ACSL3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 527-556 amino acids from the C-terminal region of human ACSL3 |
Transient overexpression lysate of acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
ACSL3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ACSL3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ACSL3 MS Standard C13 and N15-labeled recombinant protein (NP_004448)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ACSL3 MS Standard C13 and N15-labeled recombinant protein (NP_976251)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of ACSL3 (NM_004457) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACSL3 (NM_203372) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACSL3 (NM_004457) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACSL3 (NM_004457) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACSL3 (NM_203372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACSL3 (NM_203372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ACSL3
Pathways
- Metabolic pathways