Products

cDNA Clones (15)
Proteins (14)
Antibodies (7)
Jump to Filters
View as table Download
Adenylosuccinate Lyase (ADSL) (NM_000026) Human Tagged ORF Clone
RG200524

USD 460.00

In Stock

ADSL (GFP-tagged) - Human adenylosuccinate lyase (ADSL), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Adenylosuccinate Lyase (ADSL) (NM_000026) Human Tagged ORF Clone Lentiviral Particle
RC200524L3V

USD 820.00

6 Weeks

Lenti ORF particles, ADSL (Myc-DDK tagged) - Human adenylosuccinate lyase (ADSL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Adenylosuccinate Lyase (ADSL) (NM_000026) Human Tagged ORF Clone Lentiviral Particle
RC200524L4V

USD 820.00

6 Weeks

Lenti ORF particles, ADSL (mGFP-tagged) - Human adenylosuccinate lyase (ADSL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Adenylosuccinate Lyase (ADSL) (NM_001123378) Human Tagged ORF Clone Lentiviral Particle
RC225694L3V

USD 820.00

6 Weeks

Lenti ORF particles, ADSL (Myc-DDK-tagged)-Human adenylosuccinate lyase (ADSL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Adenylosuccinate Lyase (ADSL) (NM_001123378) Human Tagged ORF Clone Lentiviral Particle
RC225694L4V

USD 820.00

6 Weeks

Lenti ORF particles, ADSL (mGFP-tagged)-Human adenylosuccinate lyase (ADSL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Adenylosuccinate Lyase (ADSL) (NM_000026) Human Untagged Clone
SC110822

USD 310.00

In Stock

ADSL (untagged)-Human adenylosuccinate lyase (ADSL), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Adenylosuccinate Lyase (ADSL) (NM_000026) Human Untagged Clone
SC320633

USD 310.00

In Stock

ADSL (untagged)-Human adenylosuccinate lyase (ADSL), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Adenylosuccinate Lyase (ADSL) (NM_000026) Human Over-expression Lysate
LC424970

USD 121.00

In Stock

ADSL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Adenylosuccinate Lyase (ADSL) (NM_001123378) Human Over-expression Lysate
LC426615

USD 121.00

In Stock

ADSL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Adenylosuccinate Lyase (ADSL) (NM_001123378) Human Over-expression Lysate
LY426615

USD 396.00

In Stock

Transient overexpression lysate of adenylosuccinate lyase (ADSL), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Adenylosuccinate Lyase (ADSL) Rabbit Polyclonal Antibody
TA342801

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADSL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADSL antibody: synthetic peptide directed towards the middle region of human ADSL. Synthetic peptide located within the following region: RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI
Adenylosuccinate lyase / ASL (1-484, His-tag) Human Protein
AR50100PU-N

USD 845.00

2 Weeks

Adenylosuccinate lyase / ASL (1-484, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Adenylosuccinate lyase / ASL (1-484, His-tag) Human Protein
AR50100PU-S

USD 330.00

2 Weeks

Adenylosuccinate lyase / ASL (1-484, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Adenylosuccinate Lyase (ADSL) Mouse Monoclonal Antibody [Clone ID: OTI2D10]
CF501810

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ADSL mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Adenylosuccinate Lyase (ADSL) (NM_000026) Human Over-expression Lysate
LY424970

USD 396.00

5 Days

Transient overexpression lysate of adenylosuccinate lyase (ADSL), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Adenylosuccinate Lyase (ADSL) (NM_000026) Human Mass Spec Standard
PH300524

USD 2,055.00

3 Weeks

ADSL MS Standard C13 and N15-labeled recombinant protein (NP_000017)

Tag C-Myc/DDK
Expression Host HEK293
Adenylosuccinate Lyase (ADSL) Rabbit Polyclonal Antibody
TA323761

USD 345.00

In Stock

Anti-ADSL Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human adenylosuccinate lyase
Adenylosuccinate Lyase (ADSL) Mouse Monoclonal Antibody [Clone ID: OTI2D10]
TA501810

USD 379.00

In Stock

ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Adenylosuccinate Lyase (ADSL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D10]
TA501810AM

USD 420.00

4 Weeks

ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin
Adenylosuccinate Lyase (ADSL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D10]
TA501810BM

USD 420.00

4 Weeks

ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP
Adenylosuccinate Lyase (ADSL) Mouse Monoclonal Antibody [Clone ID: OTI2D10]
TA501810S

USD 159.00

2 Days

ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Adenylosuccinate Lyase (ADSL) ICC Control Block
TB400524

USD 1,210.00

4 Weeks

Transient overexpression of ADSL (NM_000026) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Adenylosuccinate Lyase (ADSL) ICC Control Block
TB425694

USD 1,070.00

4 Weeks

Transient overexpression of ADSL (NM_001123378) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Adenylosuccinate Lyase (ADSL) Cytosection
TS400524

USD 225.00

4 Weeks

Transient overexpression of ADSL (NM_000026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Adenylosuccinate Lyase (ADSL) Cytosection
TS400524P5

USD 889.00

4 Weeks

Transient overexpression of ADSL (NM_000026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Adenylosuccinate Lyase (ADSL) Cytosection
TS425694

USD 225.00

4 Weeks

Transient overexpression of ADSL (NM_001123378) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Adenylosuccinate Lyase (ADSL) Cytosection
TS425694P5

USD 889.00

4 Weeks

Transient overexpression of ADSL (NM_001123378) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack