Germany
Japan
United Kingdom
China
AK2 (Myc-DDK-tagged)-Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
AK2 (Myc-DDK-tagged)-Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human adenylate kinase 2 (AK2), transcript variant AK2A
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
AK2 (GFP-tagged) - Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AK2 (GFP-tagged) - Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, AK2 (Myc-DDK tagged) - Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, AK2 (mGFP-tagged) - Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, AK2 (Myc-DDK tagged) - Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AK2 (mGFP-tagged) - Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
AK2 (Myc-DDK tagged) - Homo sapiens adenylate kinase 2 (AK2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AK2 (GFP-tagged) - Homo sapiens adenylate kinase 2 (AK2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Adenylate kinase 2 / AK2 (1-239, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Adenylate kinase 2 / AK2 (1-239, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2B
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY415600 is the same product as LY429382.
AK2 (untagged)-Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
AK2 (untagged)-Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
AK2 (untagged)-Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2A
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-AK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AK2 antibody: synthetic peptide directed towards the middle region of human AK2. Synthetic peptide located within the following region: LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT |
Rabbit Polyclonal Anti-AK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AK2 antibody: synthetic peptide directed towards the N terminal of human AK2. Synthetic peptide located within the following region: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML |
AK2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
AK2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
AK2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2B
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
AK2 MS Standard C13 and N15-labeled recombinant protein (NP_001616)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
AK2 (untagged) - Homo sapiens adenylate kinase 2 (AK2), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Rabbit Polyclonal Anti-AK2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AK2 |
Transient overexpression of AK2 (NM_001625) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AK2 (NM_013411) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AK2 (NM_001199199) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AK2 (NM_001625) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AK2 (NM_001625) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of AK2 (NM_013411) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AK2 (NM_013411) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of AK2 (NM_001199199) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- AK2
Pathways
- Metabolic pathways