DMGDH (Myc-DDK-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
DMGDH (Myc-DDK-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of DMGDH (Myc-DDK-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DMGDH (Myc-DDK-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of DMGDH (mGFP-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DMGDH (mGFP-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
DMGDH (GFP-tagged) - Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-DMGDH antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DMGDH. |
DMGDH (untagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-Dmgdh Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Dmgdh antibody is: synthetic peptide directed towards the middle region of Mouse Dmgdh. Synthetic peptide located within the following region: SELHDLRWIEEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQKLTSE |
DMGDH Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of DMGDH (NM_013391) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DMGDH (NM_013391) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DMGDH (NM_013391) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack