Products

Proteins (26)
cDNA Clones (26)
Antibodies (8)
Jump to Filters
View as table Download
GALE (NM_000403) Human Tagged ORF Clone
RC201561

USD 420.00

In Stock

GALE (Myc-DDK-tagged)-Human UDP-galactose-4-epimerase (GALE), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GALE (NM_001008216) Human Tagged ORF Clone
RC208709

USD 420.00

In Stock

GALE (Myc-DDK-tagged)-Human UDP-galactose-4-epimerase (GALE), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GALE (NM_001127621) Human Tagged ORF Clone
RC225521

USD 420.00

In Stock

GALE (Myc-DDK-tagged)-Human UDP-galactose-4-epimerase (GALE), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GALE (NM_000403) Human Tagged ORF Clone Lentiviral Particle
RC201561L1V

USD 820.00

3 Weeks

Lenti ORF particles, GALE (Myc-DDK tagged) - Human UDP-galactose-4-epimerase (GALE), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GALE (NM_000403) Human Tagged ORF Clone Lentiviral Particle
RC201561L2V

USD 820.00

6 Weeks

Lenti ORF particles, GALE (mGFP-tagged) - Human UDP-galactose-4-epimerase (GALE), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GALE (NM_000403) Human Tagged ORF Clone
RG201561

USD 460.00

In Stock

GALE (GFP-tagged) - Human UDP-galactose-4-epimerase (GALE), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GALE (NM_001008216) Human Tagged ORF Clone
RG208709

USD 460.00

In Stock

GALE (GFP-tagged) - Human UDP-galactose-4-epimerase (GALE), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GALE (NM_000403) Human Tagged ORF Clone
RC201561L3

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-galactose-4-epimerase (GALE), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GALE (NM_000403) Human Tagged ORF Clone Lentiviral Particle
RC201561L3V

USD 820.00

5 Weeks

Lenti ORF particles, GALE (Myc-DDK tagged) - Human UDP-galactose-4-epimerase (GALE), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GALE (NM_000403) Human Tagged ORF Clone
RC201561L4

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-galactose-4-epimerase (GALE), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALE (NM_000403) Human Tagged ORF Clone Lentiviral Particle
RC201561L4V

USD 820.00

7 Weeks

Lenti ORF particles, GALE (mGFP-tagged) - Human UDP-galactose-4-epimerase (GALE), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALE (NM_001008216) Human Tagged ORF Clone
RC208709L3

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-galactose-4-epimerase (GALE), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GALE (NM_001008216) Human Tagged ORF Clone Lentiviral Particle
RC208709L3V

USD 820.00

6 Weeks

Lenti ORF particles, GALE (Myc-DDK tagged) - Human UDP-galactose-4-epimerase (GALE), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GALE (NM_001008216) Human Tagged ORF Clone
RC208709L4

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-galactose-4-epimerase (GALE), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALE (NM_001008216) Human Tagged ORF Clone Lentiviral Particle
RC208709L4V

USD 820.00

6 Weeks

Lenti ORF particles, GALE (mGFP-tagged) - Human UDP-galactose-4-epimerase (GALE), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALE (NM_001127621) Human Tagged ORF Clone
RC225521L3

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-galactose-4-epimerase (GALE), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GALE (NM_001127621) Human Tagged ORF Clone Lentiviral Particle
RC225521L3V

USD 820.00

6 Weeks

Lenti ORF particles, GALE (Myc-DDK tagged) - Human UDP-galactose-4-epimerase (GALE), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GALE (NM_001127621) Human Tagged ORF Clone
RC225521L4

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-galactose-4-epimerase (GALE), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALE (NM_001127621) Human Tagged ORF Clone Lentiviral Particle
RC225521L4V

USD 820.00

6 Weeks

Lenti ORF particles, GALE (mGFP-tagged) - Human UDP-galactose-4-epimerase (GALE), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALE (NM_001127621) Human Tagged ORF Clone
RG225521

USD 460.00

3 Weeks

GALE (GFP-tagged) - Human UDP-galactose-4-epimerase (GALE), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GALE (NM_000403) Human Tagged ORF Clone
RC201561L1

USD 768.00

In Stock

Lenti ORF clone of Human UDP-galactose-4-epimerase (GALE), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GALE (NM_000403) Human Untagged Clone
SC119907

USD 760.00

In Stock

GALE (untagged)-Human UDP-galactose-4-epimerase (GALE), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GALE (NM_000403) Human Over-expression Lysate
LY424739

USD 396.00

In Stock

Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GALE (NM_000403) Human Tagged ORF Clone
RC201561L2

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-galactose-4-epimerase (GALE), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GALE (BC001273) Human Untagged Clone
SC123789

USD 310.00

In Stock

GALE (untagged)-Human UDP-galactose-4-epimerase, transcript variant 2 (cDNA clone MGC:5083 IMAGE:3459004), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GALE (NM_000403) Human Over-expression Lysate
LC424739

USD 121.00

In Stock

GALE HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GALE (NM_001008216) Human Untagged Clone
SC323855

USD 760.00

In Stock

GALE (untagged)-Human UDP-galactose-4-epimerase (GALE), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GALE (Center) Rabbit Polyclonal Antibody
AP17410PU-N

USD 450.00

2 Weeks

GALE (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human GALE
GALE Rabbit Polyclonal Antibody
TA334924

USD 375.00

5 Days

Rabbit Polyclonal Anti-GALE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALE antibody: synthetic peptide directed towards the N terminal of human GALE. Synthetic peptide located within the following region: AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR
GALE Rabbit Polyclonal Antibody
TA334925

USD 375.00

5 Days

Rabbit Polyclonal Anti-GALE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALE antibody: synthetic peptide directed towards the middle region of human GALE. Synthetic peptide located within the following region: PQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKG
GALE (1-348, His-tag) Human Protein
AR09551PU-L

USD 745.00

2 Weeks

GALE (1-348, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
GALE (1-348, His-tag) Human Protein
AR09551PU-N

USD 300.00

2 Weeks

GALE (1-348, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
GALE Mouse Monoclonal Antibody [Clone ID: OTI1C4]
CF502146

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
GALE (NM_001008216) Human Over-expression Lysate
LC423394

USD 121.00

2 Weeks

GALE HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GALE (NM_001127621) Human Over-expression Lysate
LC426826

USD 121.00

2 Weeks

GALE HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GALE (NM_001008216) Human Over-expression Lysate
LY423394

USD 396.00

5 Days

Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GALE (NM_001127621) Human Over-expression Lysate
LY426826

USD 396.00

5 Days

Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GALE (NM_000403) Human Mass Spec Standard
PH301561

USD 2,055.00

3 Weeks

GALE MS Standard C13 and N15-labeled recombinant protein (NP_000394)

Tag C-Myc/DDK
Expression Host HEK293
GALE (NM_001008216) Human Mass Spec Standard
PH308709

USD 2,055.00

3 Weeks

GALE MS Standard C13 and N15-labeled recombinant protein (NP_001008217)

Tag C-Myc/DDK
Expression Host HEK293
GALE (NM_001127621) Human Mass Spec Standard
PH325521

USD 2,055.00

3 Weeks

GALE MS Standard C13 and N15-labeled recombinant protein (NP_001121093)

Tag C-Myc/DDK
Expression Host HEK293
GALE (NM_001127621) Human Untagged Clone
SC322994

USD 760.00

3 Weeks

GALE (untagged)-Human UDP-galactose-4-epimerase (GALE), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GALE Mouse Monoclonal Antibody [Clone ID: OTI1C4]
TA502146

USD 379.00

In Stock

GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
GALE Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C4]
TA502146AM

USD 420.00

4 Weeks

GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), Biotinylated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin
GALE Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C4]
TA502146BM

USD 420.00

4 Weeks

GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), HRP conjugated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP
GALE Mouse Monoclonal Antibody [Clone ID: OTI1C4]
TA502146S

USD 159.00

2 Days

GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
GALE ICC Control Block
TB401561

USD 1,070.00

4 Weeks

Transient overexpression of GALE (NM_000403) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GALE ICC Control Block
TB408709

USD 1,070.00

4 Weeks

Transient overexpression of GALE (NM_001008216) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GALE ICC Control Block
TB425521

USD 1,070.00

4 Weeks

Transient overexpression of GALE (NM_001127621) in HEK293T cells paraffin embedded controls for ICC/IHC staining