GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GPT2 (GFP-tagged) - Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GPT2 (Myc-DDK tagged) - Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GPT2 (mGFP-tagged) - Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GPT2 (mGFP-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GPT2 (mGFP-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GPT2 (GFP-tagged) - Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GPT2 (untagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-GPT2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPT2 antibody: synthetic peptide directed towards the C terminal of human GPT2. Synthetic peptide located within the following region: PEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVR |
GPT2 (untagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GPT2 (1-523, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
GPT2 (1-523, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
GPT2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GPT2 MS Standard C13 and N15-labeled recombinant protein (NP_597700)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GPT2 (untagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of GPT2 (NM_133443) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPT2 (NM_001142466) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPT2 (NM_133443) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPT2 (NM_133443) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GPT2 (NM_001142466) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack