Products

cDNA Clones (28)
Proteins (12)
RNAi (12)
Gene Expression (7)
Antibodies (3)
Jump to Filters
View as table Download
GPT2 (NM_133443) Human Tagged ORF Clone
RC209119

USD 420.00

In Stock

GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Gpt2 (NM_173866) Mouse Tagged ORF Clone
MR208364

USD 480.00

In Stock

Gpt2 (Myc-DDK-tagged) - Mouse glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPT2 (NM_133443) Human Tagged ORF Clone
RG209119

USD 460.00

In Stock

GPT2 (GFP-tagged) - Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPT2 Human Gene Knockout Kit (CRISPR)
KN409119

USD 1,290.00

2 Weeks

GPT2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN409119 is the updated version of KN209119.
Gpt2 Mouse Gene Knockout Kit (CRISPR)
KN507285

USD 1,290.00

2 Weeks

Gpt2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507285 is the updated version of KN307285.
Gpt2 (NM_173866) Mouse Tagged ORF Clone
MG208364

USD 530.00

3 Weeks

Gpt2 (GFP-tagged) - Mouse glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gpt2 (NM_173866) Mouse Tagged ORF Clone
MR208364L3

USD 680.00

3 Weeks

Lenti ORF clone of Gpt2 (Myc-DDK-tagged) - Mouse glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gpt2 (NM_173866) Mouse Tagged ORF Clone Lentiviral Particle
MR208364L3V

USD 880.00

6 Weeks

Lenti ORF particles, Gpt2 (Myc-DDK-tagged) - Mouse glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gpt2 (NM_173866) Mouse Tagged ORF Clone
MR208364L4

USD 680.00

3 Weeks

Lenti ORF clone of Gpt2 (mGFP-tagged) - Mouse glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gpt2 (NM_173866) Mouse Tagged ORF Clone Lentiviral Particle
MR208364L4V

USD 880.00

6 Weeks

Lenti ORF particles, Gpt2 (GFP-tagged) - Mouse glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPT2 (NM_133443) Human Tagged ORF Clone
RC209119L3

USD 620.00

3 Weeks

Lenti ORF clone of Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPT2 (NM_133443) Human Tagged ORF Clone Lentiviral Particle
RC209119L3V

USD 820.00

6 Weeks

Lenti ORF particles, GPT2 (Myc-DDK tagged) - Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPT2 (NM_133443) Human Tagged ORF Clone
RC209119L4

USD 620.00

3 Weeks

Lenti ORF clone of Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPT2 (NM_133443) Human Tagged ORF Clone Lentiviral Particle
RC209119L4V

USD 820.00

6 Weeks

Lenti ORF particles, GPT2 (mGFP-tagged) - Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPT2 (NM_001142466) Human Tagged ORF Clone
RC226830

USD 550.00

3 Weeks

GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPT2 (NM_001142466) Human Tagged ORF Clone
RC226830L3

USD 750.00

8 Weeks

Lenti-ORF clone of GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPT2 (NM_001142466) Human Tagged ORF Clone Lentiviral Particle
RC226830L3V

USD 950.00

11 Weeks

Lenti ORF particles, GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPT2 (NM_001142466) Human Tagged ORF Clone
RC226830L4

USD 750.00

8 Weeks

Lenti-ORF clone of GPT2 (mGFP-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPT2 (NM_001142466) Human Tagged ORF Clone Lentiviral Particle
RC226830L4V

USD 950.00

11 Weeks

Lenti ORF particles, GPT2 (mGFP-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPT2 (NM_001142466) Human Tagged ORF Clone
RG226830

USD 600.00

3 Weeks

GPT2 (GFP-tagged) - Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gpt2 (NM_001012057) Rat Tagged ORF Clone
RR202515

USD 710.00

5 Weeks

Gpt2 (Myc-DDK-tagged ORF) - Rat glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gpt2 (NM_001012057) Rat Tagged ORF Clone
RR202515L3

USD 910.00

10 Weeks

Lenti ORF clone of Gpt2 (Myc-DDK-tagged ORF) - Rat glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gpt2 (NM_001012057) Rat Tagged ORF Clone Lentiviral Particle
RR202515L3V

USD 1,120.00

14 Weeks

Lenti ORF particles, Gpt2 (Myc-DDK-tagged ORF) - Rat glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gpt2 (NM_001012057) Rat Tagged ORF Clone
RR202515L4

USD 1,000.00

10 Weeks

Lenti ORF clone of Gpt2 (mGFP-tagged ORF) - Rat glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gpt2 (NM_001012057) Rat Tagged ORF Clone Lentiviral Particle
RR202515L4V

USD 1,260.00

14 Weeks

Lenti ORF particles, Gpt2 (GFP-tagged ORF) - Rat glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPT2 Rabbit Polyclonal Antibody
TA372685

USD 380.00

4 Weeks

GPT2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPT2
GPT2 (NM_133443) Human Over-expression Lysate
LY408784

USD 396.00

5 Days

Transient overexpression lysate of glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GPT2 (NM_133443) Human Untagged Clone
SC120520

USD 760.00

In Stock

GPT2 (untagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GPT2 Human siRNA Oligo Duplex (Locus ID 84706)
SR313641

USD 430.00

In Stock

GPT2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

GPT2 Rabbit Polyclonal Antibody
TA329574

USD 375.00

5 Days

Rabbit polyclonal anti-GPT2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPT2 antibody: synthetic peptide directed towards the C terminal of human GPT2. Synthetic peptide located within the following region: PEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVR
GPT2 (NM_133443) Human Untagged Clone
SC320514

USD 760.00

In Stock

GPT2 (untagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GPT2 (1-523, His-tag) Human Protein
AR50738PU-N

USD 1,105.00

2 Weeks

GPT2 (1-523, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
GPT2 (1-523, His-tag) Human Protein
AR50738PU-S

USD 415.00

2 Weeks

GPT2 (1-523, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Human GPT2 activation kit by CRISPRa
GA113668

USD 1,290.00

2 Weeks

GPT2 CRISPRa kit - CRISPR gene activation of human glutamic--pyruvic transaminase 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Gpt2 activation kit by CRISPRa
GA212127

USD 1,290.00

2 Weeks

Gpt2 CRISPRa kit - CRISPR gene activation of mouse glutamic pyruvate transaminase (alanine aminotransferase) 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
GPT2 Human qPCR Template Standard (NM_133443)
HK211629

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GPT2

Application Plasmid of exact quantity for transcript copy number calculation
GPT2 Human qPCR Primer Pair (NM_133443)
HP216850

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene GPT2

GPT2 (NM_133443) Human Over-expression Lysate
LC408784

USD 121.00

2 Weeks

GPT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Gpt2 (NM_173866) Mouse Untagged Clone
MC217501

USD 710.00

5 Weeks

Gpt2 (untagged) - Mouse glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Gpt2 Mouse qPCR Primer Pair (NM_173866)
MP205550

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Gpt2

GPT2 (NM_133443) Human Mass Spec Standard
PH309119

USD 2,055.00

3 Weeks

GPT2 MS Standard C13 and N15-labeled recombinant protein (NP_597700)

Tag C-Myc/DDK
Expression Host HEK293
Gpt2 (NM_001012057) Rat Untagged Clone
RN202515

USD 710.00

6 Weeks

Gpt2 (untagged ORF) - Rat glutamic pyruvate transaminase (alanine aminotransferase) 2 (Gpt2), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GPT2 (NM_001142466) Human Untagged Clone
SC325083

USD 760.00

3 Weeks

GPT2 (untagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2

Vector pCMV6 series
Tag Tag Free
Gpt2 Mouse siRNA Oligo Duplex (Locus ID 108682)
SR416626

USD 430.00

2 Weeks

Gpt2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Gpt2 Rat siRNA Oligo Duplex (Locus ID 307759)
SR502229

USD 430.00

2 Weeks

Gpt2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

GPT2 Rabbit Polyclonal Antibody
TA368451

USD 380.00

4 Weeks

GPT2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPT2
GPT2 (NM_133443) ICC Control Block
TB409119

USD 1,070.00

4 Weeks

Transient overexpression of GPT2 (NM_133443) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPT2 (NM_001142466) ICC Control Block
TB426830

USD 1,200.00

4 Weeks

Transient overexpression of GPT2 (NM_001142466) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPT2 Human shRNA Plasmid Kit (Locus ID 84706)
TL304214

USD 815.00

2 Weeks

GPT2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti