Products

cDNA Clones (27)
Proteins (14)
Antibodies (12)
Jump to Filters
View as table Download
PCCA (NM_000282) Human Tagged ORF Clone
RC214832

USD 610.00

In Stock

PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PCCA (NM_001178004) Human Tagged ORF Clone
RC230422

USD 610.00

In Stock

PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PCCA (NM_000282) Human Recombinant Protein
TP314832

USD 867.00

In Stock

Recombinant protein of human propionyl Coenzyme A carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

PCCA (NM_000282) Human Tagged ORF Clone Lentiviral Particle
RC214832L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, PCCA (Myc-DDK tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PCCA (NM_000282) Human Tagged ORF Clone Lentiviral Particle
RC214832L2V

USD 1,010.00

6 Weeks

Lenti ORF particles, PCCA (mGFP-tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PCCA (NM_000282) Human Tagged ORF Clone
RG214832

USD 670.00

In Stock

PCCA (GFP-tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PCCA (NM_000282) Human Tagged ORF Clone
RC214832L3

USD 810.00

3 Weeks

Lenti ORF clone of Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCA (NM_000282) Human Tagged ORF Clone Lentiviral Particle
RC214832L3V

USD 1,010.00

5 Weeks

Lenti ORF particles, PCCA (Myc-DDK tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCA (NM_000282) Human Tagged ORF Clone
RC214832L4

USD 810.00

3 Weeks

Lenti ORF clone of Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCA (NM_000282) Human Tagged ORF Clone Lentiviral Particle
RC214832L4V

USD 1,010.00

7 Weeks

Lenti ORF particles, PCCA (mGFP-tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCA (NM_001127692) Human Tagged ORF Clone
RC226100

USD 610.00

4 Weeks

PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCCA (NM_001127692) Human Tagged ORF Clone
RC226100L3

USD 810.00

4 Weeks

Lenti-ORF clone of PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCA (NM_001127692) Human Tagged ORF Clone Lentiviral Particle
RC226100L3V

USD 1,010.00

7 Weeks

Lenti ORF particles, PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCA (NM_001127692) Human Tagged ORF Clone
RC226100L4

USD 810.00

4 Weeks

Lenti-ORF clone of PCCA (mGFP-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCA (NM_001127692) Human Tagged ORF Clone Lentiviral Particle
RC226100L4V

USD 1,010.00

7 Weeks

Lenti ORF particles, PCCA (mGFP-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCA (NM_001178004) Human Tagged ORF Clone
RC230422L3

USD 810.00

3 Weeks

Lenti-ORF clone of PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCA (NM_001178004) Human Tagged ORF Clone Lentiviral Particle
RC230422L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCA (NM_001178004) Human Tagged ORF Clone
RC230422L4

USD 810.00

3 Weeks

Lenti-ORF clone of PCCA (mGFP-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCA (NM_001178004) Human Tagged ORF Clone Lentiviral Particle
RC230422L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, PCCA (mGFP-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCA (NM_001127692) Human Tagged ORF Clone
RG226100

USD 670.00

5 Weeks

PCCA (GFP-tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PCCA (NM_001178004) Human Tagged ORF Clone
RG230422

USD 670.00

3 Weeks

PCCA (GFP-tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PCCA (NM_000282) Human Tagged ORF Clone
RC214832L1

USD 1,008.00

In Stock

Lenti ORF clone of Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PCCA (NM_000282) Human Over-expression Lysate
LY400108

USD 605.00

In Stock

Transient overexpression lysate of propionyl Coenzyme A carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PCCA (NM_000282) Human Untagged Clone
SC120017

USD 1,470.00

In Stock

PCCA (untagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PCCA (NM_001178004) Human Over-expression Lysate
LC433422

USD 187.00

In Stock

PCCA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PCCA (NM_001178004) Human Over-expression Lysate
LY433422

USD 605.00

In Stock

Transient overexpression lysate of propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PCCA (NM_000282) Human Tagged ORF Clone
RC214832L2

USD 810.00

3 Weeks

Lenti ORF clone of Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PCCA Rabbit Polyclonal Antibody
TA332364

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCCA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCCA Antibody: synthetic peptide directed towards the N terminal of human PCCA. Synthetic peptide located within the following region: LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI
PCCA (Center) Rabbit Polyclonal Antibody
AP53192PU-N

USD 450.00

2 Weeks

PCCA (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 336-365 amino acids from the Central region of human PCCA
PCCA (AF385926) Human Untagged Clone
SC106305

USD 660.00

In Stock

(untagged)-Human propionyl-CoA carboxylase alpha subunit (PCCA) mRNA, complete cds, nuclear gene for mitochondrial product

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PCCA Mouse Monoclonal Antibody [Clone ID: OTI1B10]
CF810969

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PCCA mouse monoclonal antibody,clone OTI1B10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PCCA Mouse Monoclonal Antibody [Clone ID: OTI1E9]
CF811046

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PCCA mouse monoclonal antibody,clone OTI1E9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PCCA (NM_000282) Human Over-expression Lysate
LC400108

USD 187.00

2 Weeks

PCCA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
PCCA (NM_000282) Human Mass Spec Standard
PH314832

USD 2,055.00

3 Weeks

PCCA MS Standard C13 and N15-labeled recombinant protein (NP_000273)

Tag C-Myc/DDK
Expression Host HEK293
PCCA (NM_000282) Human Untagged Clone
SC318212

USD 1,470.00

3 Weeks

PCCA (untagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PCCA (NM_001127692) Human Untagged Clone
SC323177

USD 1,430.00

5 Weeks

PCCA (untagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2

Vector pCMV6 series
Tag Tag Free
PCCA (NM_001178004) Human Untagged Clone
SC329060

USD 1,390.00

3 Weeks

PCCA (untagged)-Human propionyl CoA carboxylase alpha polypeptide (PCCA) transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PCCA Mouse Monoclonal Antibody [Clone ID: OTI1B10]
TA810969

USD 379.00

In Stock

PCCA mouse monoclonal antibody,clone OTI1B10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PCCA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B10]
TA810969AM

USD 420.00

4 Weeks

PCCA mouse monoclonal antibody,clone OTI1B10, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
PCCA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B10]
TA810969BM

USD 420.00

4 Weeks

PCCA mouse monoclonal antibody,clone OTI1B10, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
PCCA Mouse Monoclonal Antibody [Clone ID: OTI1B10]
TA810969S

USD 159.00

2 Days

PCCA mouse monoclonal antibody,clone OTI1B10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PCCA Mouse Monoclonal Antibody [Clone ID: OTI1E9]
TA811046

USD 379.00

In Stock

PCCA mouse monoclonal antibody,clone OTI1E9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PCCA Mouse Monoclonal Antibody [Clone ID: OTI1E9]
TA811046S

USD 159.00

2 Days

PCCA mouse monoclonal antibody,clone OTI1E9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PCCA ICC Control Block
TB414832

USD 1,260.00

4 Weeks

Transient overexpression of PCCA (NM_000282) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PCCA ICC Control Block
TB426100

USD 1,260.00

4 Weeks

Transient overexpression of PCCA (NM_001127692) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PCCA ICC Control Block
TB430422

USD 1,260.00

4 Weeks

Transient overexpression of PCCA (NM_001178004) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PCCA Cytosection
TS414832

USD 225.00

4 Weeks

Transient overexpression of PCCA (NM_000282) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PCCA Cytosection
TS414832P5

USD 889.00

4 Weeks

Transient overexpression of PCCA (NM_000282) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack