Products

View as table Download

PCK1 (Myc-DDK-tagged)-Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, PCK1 (Myc-DDK tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, PCK1 (mGFP-tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

PCK1 (GFP-tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PCK1 (Myc-DDK tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PCK1 (mGFP-tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

PCK1 (untagged)-Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

PCK1 Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human PCK1

Rabbit Polyclonal PCK1 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Goat Polyclonal Antibody against PCK1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKEVEDIEKYLEDQ, from the internal region (near the C Terminus) of the protein sequence according to NP_002582.2.

Rabbit Polyclonal Anti-PCK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS

PCK1 (513-524) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bat, Canine, Equine, Human, Monkey, Rabbit
Immunogen Synthetic peptide from an internal region of human PCK1

PCK1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Goat Anti-PCK1 / PEPCKC (internal) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3.

Rabbit polyclonal anti-PEPCK-C antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surroundign amino acid 507 of mouse PEPCK-C

Rabbit Polyclonal Anti-PCK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the N terminal of human PCK1. Synthetic peptide located within the following region: PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE

Rabbit Polyclonal Anti-PCK1 Antibody

Applications WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS

PCK1 / PEPCK1 (1-622, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

PCK1 / PEPCK1 (1-622, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

PCK1 MS Standard C13 and N15-labeled recombinant protein (NP_002582)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-PCK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PCK1

USD 1,070.00

4 Weeks

Transient overexpression of PCK1 (NM_002591) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of PCK1 (NM_002591) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PCK1 (NM_002591) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack