Germany
Japan
United Kingdom
China
XDH (Myc-DDK-tagged)-Human xanthine dehydrogenase (XDH)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human xanthine dehydrogenase (XDH)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 1,800.00
3 Weeks
Lenti ORF particles, XDH (Myc-DDK tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,800.00
6 Weeks
Lenti ORF particles, XDH (mGFP-tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
XDH (GFP-tagged) - Human xanthine dehydrogenase (XDH)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human xanthine dehydrogenase (XDH), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,800.00
5 Weeks
Lenti ORF particles, XDH (Myc-DDK tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human xanthine dehydrogenase (XDH), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,800.00
7 Weeks
Lenti ORF particles, XDH (mGFP-tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human xanthine dehydrogenase (XDH), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
XDH HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
XDH (untagged)-Human xanthine dehydrogenase (XDH)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of xanthine dehydrogenase (XDH)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human xanthine dehydrogenase (XDH), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Xanthine Oxidase (XDH) guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Xanthine Oxidase purified from Bovine Milk Fat Globule Membrane (MFGM). |
Rabbit Polyclonal Anti-XDH Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS |
Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI5D8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI1C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
XDH MS Standard C13 and N15-labeled recombinant protein (NP_000370)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
XDH mouse monoclonal antibody,clone OTI5D8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI5D8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI5D8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
XDH mouse monoclonal antibody,clone OTI5D8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
XDH mouse monoclonal antibody,clone OTI1C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI1C10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI1C10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
XDH mouse monoclonal antibody,clone OTI1C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of XDH (NM_000379) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of XDH (NM_000379) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of XDH (NM_000379) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- XDH
Pathways
- Metabolic pathways