Products

cDNA Clones (18)
Proteins (11)
Antibodies (2)
Jump to Filters
View as table Download
ADH6 (NM_001102470) Human Tagged ORF Clone
RC219515

USD 98.00

USD 460.00

In Stock

ADH6 (Myc-DDK-tagged)-Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ADH6 (NM_000672) Human Tagged ORF Clone Lentiviral Particle
RC219471L1V

USD 820.00

3 Weeks

Lenti ORF particles, ADH6 (Myc-DDK tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ADH6 (NM_000672) Human Tagged ORF Clone Lentiviral Particle
RC219471L2V

USD 820.00

6 Weeks

Lenti ORF particles, ADH6 (mGFP-tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ADH6 (NM_000672) Human Tagged ORF Clone
RC219471

USD 420.00

In Stock

ADH6 (Myc-DDK-tagged)-Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ADH6 (NM_000672) Human Tagged ORF Clone
RG219471

USD 460.00

In Stock

ADH6 (GFP-tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADH6 (NM_000672) Human Tagged ORF Clone
RC219471L3

USD 620.00

3 Weeks

Lenti ORF clone of Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ADH6 (NM_000672) Human Tagged ORF Clone Lentiviral Particle
RC219471L3V

USD 820.00

6 Weeks

Lenti ORF particles, ADH6 (Myc-DDK tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ADH6 (NM_000672) Human Tagged ORF Clone
RC219471L4

USD 620.00

3 Weeks

Lenti ORF clone of Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADH6 (NM_000672) Human Tagged ORF Clone Lentiviral Particle
RC219471L4V

USD 820.00

6 Weeks

Lenti ORF particles, ADH6 (mGFP-tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADH6 (NM_001102470) Human Tagged ORF Clone
RC219515L3

USD 620.00

3 Weeks

Lenti ORF clone of Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ADH6 (NM_001102470) Human Tagged ORF Clone Lentiviral Particle
RC219515L3V

USD 820.00

6 Weeks

Lenti ORF particles, ADH6 (Myc-DDK tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ADH6 (NM_001102470) Human Tagged ORF Clone
RC219515L4

USD 620.00

3 Weeks

Lenti ORF clone of Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADH6 (NM_001102470) Human Tagged ORF Clone Lentiviral Particle
RC219515L4V

USD 820.00

6 Weeks

Lenti ORF particles, ADH6 (mGFP-tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADH6 (NM_001102470) Human Tagged ORF Clone
RG219515

USD 460.00

3 Weeks

ADH6 (GFP-tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADH6 Rabbit Polyclonal Antibody
TA346214

USD 410.00

5 Days

Rabbit Polyclonal Anti-ADH6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH6 antibody: synthetic peptide directed towards the middle region of human ADH6. Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID
ADH6 (Center) Rabbit Polyclonal Antibody
AP50091PU-N

USD 450.00

2 Weeks

ADH6 (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 217~247 amino acids from the Center region of human ADH6
ADH6 (NM_000672) Human Tagged ORF Clone
RC219471L1

USD 620.00

In Stock

Lenti ORF clone of Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ADH6 (NM_000672) Human Tagged ORF Clone
RC219471L2

USD 620.00

3 Weeks

Lenti ORF clone of Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ADH6 (NM_000672) Human Untagged Clone
SC107930

USD 630.00

In Stock

ADH6 (untagged)-Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
ADH6 (NM_001102470) Human Untagged Clone
SC316928

USD 640.00

In Stock

ADH6 (untagged)-Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Alcohol dehydrogenase 6 / ADH6 (1-375, His-tag) Human Protein
AR50388PU-N

USD 845.00

2 Weeks

Alcohol dehydrogenase 6 / ADH6 (1-375, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Alcohol dehydrogenase 6 / ADH6 (1-375, His-tag) Human Protein
AR50388PU-S

USD 330.00

2 Weeks

Alcohol dehydrogenase 6 / ADH6 (1-375, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
ADH6 (NM_001102470) Human Over-expression Lysate
LC420155

USD 121.00

2 Weeks

ADH6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ADH6 (NM_001102470) Human Over-expression Lysate
LY420155

USD 396.00

5 Days

Transient overexpression lysate of alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ADH6 (NM_001102470) Human Mass Spec Standard
PH319515

USD 2,055.00

3 Weeks

ADH6 MS Standard C13 and N15-labeled recombinant protein (NP_001095940)

Tag C-Myc/DDK
Expression Host HEK293
ADH6 ICC Control Block
TB419471

USD 1,070.00

4 Weeks

Transient overexpression of ADH6 (NM_000672) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ADH6 ICC Control Block
TB419515

USD 1,110.00

4 Weeks

Transient overexpression of ADH6 (NM_001102470) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ADH6 Cytosection
TS419471

USD 225.00

4 Weeks

Transient overexpression of ADH6 (NM_000672) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ADH6 Cytosection
TS419471P5

USD 889.00

4 Weeks

Transient overexpression of ADH6 (NM_000672) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ADH6 Cytosection
TS419515

USD 225.00

4 Weeks

Transient overexpression of ADH6 (NM_001102470) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ADH6 Cytosection
TS419515P5

USD 889.00

4 Weeks

Transient overexpression of ADH6 (NM_001102470) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack