Germany
Japan
United Kingdom
China
CYP2B6 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 850.00
3 Weeks
Lenti ORF particles, CYP2B6 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 850.00
6 Weeks
Lenti ORF particles, CYP2B6 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CYP2B6 (untagged)-Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
CYP2B6 (GFP-tagged) - Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 850.00
5 Weeks
Lenti ORF particles, CYP2B6 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 850.00
3 Weeks
Lenti ORF particles, CYP2B6 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit polyclonal CYP2B6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP2B6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-263 amino acids from the Central region of human CYP2B6. |
Rabbit Polyclonal Anti-CYP2B6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL |
Rabbit Polyclonal Anti-Cytochrome P450 2B6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cytochrome P450 2B6 Antibody: A synthesized peptide derived from human Cytochrome P450 2B6 |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal Cytochrome P450 2B6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2B6. |
| Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 2B6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Cytochrome P450 2B6. |
| Modifications | Phospho-specific |
CYP2B6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP2B6 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
CYP2B6 MS Standard C13 and N15-labeled recombinant protein (NP_000758)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 379.00
In Stock
USD 420.00
4 Weeks
CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), Biotinylated
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), HRP conjugated
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | HRP |
USD 159.00
In Stock
Transient overexpression of CYP2B6 (NM_000767) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP2B6 (NM_000767) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP2B6 (NM_000767) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYP2B6
Pathways
- Metabolism of xenobiotics by cytochrome P450