Products

cDNA Clones (30)
Proteins (25)
Antibodies (19)
Jump to Filters
View as table Download
CD95 (FAS) (NM_000043) Human Tagged ORF Clone
RC204520

USD 420.00

In Stock

FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CD95 (FAS) (NM_152871) Human Tagged ORF Clone
RC215929

USD 420.00

In Stock

FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CD95 (FAS) (NM_152876) Human Tagged ORF Clone
RC211839

USD 98.00

USD 390.00

In Stock

FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CD95 (FAS) (NM_000043) Human Tagged ORF Clone
RG204520

USD 460.00

In Stock

FAS (GFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD95 (FAS) (NM_000043) Human Recombinant Protein
TP304520

USD 823.00

In Stock

Recombinant protein of human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
CD95 (FAS) (NM_152872) Human Tagged ORF Clone
RG211622

USD 460.00

In Stock

FAS (GFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD95 (FAS) (NM_000043) Human Untagged Clone
SC321759

USD 310.00

In Stock

FAS (untagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CD95 (FAS) (NM_000043) Human Tagged ORF Clone Lentiviral Particle
RC204520L1V

USD 820.00

3 Weeks

Lenti ORF particles, FAS (Myc-DDK tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CD95 (FAS) (NM_000043) Human Tagged ORF Clone Lentiviral Particle
RC204520L2V

USD 820.00

6 Weeks

Lenti ORF particles, FAS (mGFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CD95 (FAS) (NM_152871) Human Tagged ORF Clone
RG215929

USD 460.00

In Stock

FAS (GFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD95 (FAS) (NM_000043) Human Tagged ORF Clone
RC204520L4

USD 620.00

In Stock

Lenti ORF clone of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152876) Human Tagged ORF Clone
RG211839

USD 460.00

In Stock

FAS (GFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD95 (FAS) (NM_000043) Human Tagged ORF Clone Lentiviral Particle
RC204520L3V

USD 820.00

In Stock

Lenti ORF particles, FAS (Myc-DDK tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_000043) Human Tagged ORF Clone Lentiviral Particle
RC204520L4V

USD 820.00

3 Weeks

Lenti ORF particles, FAS (mGFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152872) Human Tagged ORF Clone
RC211622

USD 420.00

3 Weeks

FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CD95 (FAS) (NM_152872) Human Tagged ORF Clone
RC211622L3

USD 620.00

3 Weeks

Lenti-ORF clone of FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152872) Human Tagged ORF Clone Lentiviral Particle
RC211622L3V

USD 820.00

6 Weeks

Lenti ORF particles, FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152872) Human Tagged ORF Clone
RC211622L4

USD 620.00

3 Weeks

Lenti-ORF clone of FAS (mGFP-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152872) Human Tagged ORF Clone Lentiviral Particle
RC211622L4V

USD 820.00

6 Weeks

Lenti ORF particles, FAS (mGFP-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152876) Human Tagged ORF Clone
RC211839L3

USD 620.00

3 Weeks

Lenti ORF clone of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152876) Human Tagged ORF Clone Lentiviral Particle
RC211839L3V

USD 820.00

6 Weeks

Lenti ORF particles, FAS (Myc-DDK tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152876) Human Tagged ORF Clone
RC211839L4

USD 620.00

3 Weeks

Lenti ORF clone of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152876) Human Tagged ORF Clone Lentiviral Particle
RC211839L4V

USD 820.00

6 Weeks

Lenti ORF particles, FAS (mGFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152871) Human Tagged ORF Clone
RC215929L3

USD 620.00

3 Weeks

Lenti-ORF clone of FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152871) Human Tagged ORF Clone Lentiviral Particle
RC215929L3V

USD 820.00

6 Weeks

Lenti ORF particles, FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152871) Human Tagged ORF Clone
RC215929L4

USD 620.00

3 Weeks

Lenti-ORF clone of FAS (mGFP-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_152871) Human Tagged ORF Clone Lentiviral Particle
RC215929L4V

USD 820.00

6 Weeks

Lenti ORF particles, FAS (mGFP-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD95 (FAS) (NM_000043) Human Tagged ORF Clone
RC204520L1

USD 768.00

In Stock

Lenti ORF clone of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CD95 (FAS) (NM_000043) Human Recombinant Protein
TP723411

USD 240.00

5 Days

Purified recombinant protein of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1.

Tag Tag Free
Expression Host E. coli
CD95 (FAS) Rabbit Polyclonal Antibody
TA313381

USD 345.00

In Stock

Rabbit polyclonal anti-FAS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.
CD95 (FAS) Rabbit Polyclonal Antibody
TA326787

USD 275.00

3 Weeks

FAS Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FAS
CD95 (FAS) Rabbit Polyclonal Antibody
TA590390

USD 409.00

In Stock

Rabbit Polyclonal Fas Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
CD95 (FAS) (NM_000043) Human Tagged ORF Clone
RC204520L2

USD 620.00

3 Weeks

Lenti ORF clone of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CD95 Mouse Monoclonal Antibody [Clone ID: EOS9.1]
TA320327

USD 170.00

5 Days

Mouse Anti-Human CD95 (APO-1/Fas) Purified

Applications FC
Reactivities Human
CD95 (FAS) Rabbit Polyclonal Antibody
AP06448PU-N

USD 370.00

2 Weeks

CD95 (FAS) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 280-330 of Human CD95.
CD95 (FAS) (NM_152871) Human Over-expression Lysate
LC407241

USD 121.00

In Stock

FAS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD95 (FAS) (NM_152876) Human Over-expression Lysate
LC407246

USD 121.00

In Stock

FAS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD95 (FAS) (NM_000043) Human Over-expression Lysate
LC424961

USD 121.00

In Stock

FAS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD95 (FAS) (NM_152876) Human Recombinant Protein
TP761886

USD 215.00

In Stock

Purified recombinant protein of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6, full length, with N-terminal GST and C-terminal His tag,, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
CD95 (FAS) (Center) Rabbit Polyclonal Antibody
AP18016PU-N

USD 450.00

2 Weeks

CD95 (FAS) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen conjugated synthetic peptide selected from the Center region of human FAS
CD95 (FAS) (323-327) Rabbit Polyclonal Antibody
AP26059PU-N

USD 300.00

2 Weeks

CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa.323~327 derived from human Fas .
CD95 (FAS) (323-327) Rabbit Polyclonal Antibody
AP26059PU-S

USD 230.00

2 Weeks

CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa.323~327 derived from human Fas .
CD95 (FAS) Goat Polyclonal Antibody
TA305714

USD 375.00

5 Days

Goat Anti-FAS / CD95 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1.
CD95 (FAS) Rabbit Polyclonal Antibody
TA337864

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: 4C3-G7-B7-H5]
TA346945

USD 380.00

4 Weeks

Mouse Monoclonal FAS (C-terminus) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
CD95 (FAS) Rabbit Polyclonal Antibody
TA354221

USD 355.00

5 Days

Rabbit anti CD95 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
CD95 (FAS) (NM_000043) Human Recombinant Protein
TP721062

USD 330.00

3 Weeks

Purified recombinant protein of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1

Tag C-His
Expression Host HEK293