Germany
Japan
United Kingdom
China
RAET1E (Myc-DDK-tagged)-Human retinoic acid early transcript 1E (RAET1E)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
RAET1E (GFP-tagged) - Human retinoic acid early transcript 1E (RAET1E)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human retinoic acid early transcript 1E (RAET1E), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, RAET1E (Myc-DDK tagged) - Human retinoic acid early transcript 1E (RAET1E), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, RAET1E (mGFP-tagged) - Human retinoic acid early transcript 1E (RAET1E), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
RAET1E (Myc-DDK tagged) - Homo sapiens retinoic acid early transcript 1E (RAET1E), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAET1E (Myc-DDK tagged) - Homo sapiens retinoic acid early transcript 1E (RAET1E), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAET1E (Myc-DDK tagged) - Homo sapiens retinoic acid early transcript 1E (RAET1E), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAET1E (GFP-tagged) - Homo sapiens retinoic acid early transcript 1E (RAET1E), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAET1E (GFP-tagged) - Homo sapiens retinoic acid early transcript 1E (RAET1E), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAET1E (GFP-tagged) - Homo sapiens retinoic acid early transcript 1E (RAET1E), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-RAET1E Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | RAET1E antibody was raised against an 18 amino acid peptide near the center of human RAET1E. |
Transient overexpression lysate of retinoic acid early transcript 1E (RAET1E)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-RAET1E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAET1E antibody is: synthetic peptide directed towards the C-terminal region of Human RAET1E. Synthetic peptide located within the following region: LEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDR |
RAET1E (31-225, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
RAET1E (31-225, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
RAET1E HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RAET1E (untagged)-Human retinoic acid early transcript 1E (RAET1E)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC316696 is the updated version of SC306124.
RAET1E (untagged) - Homo sapiens retinoic acid early transcript 1E (RAET1E), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
RAET1E (untagged) - Homo sapiens retinoic acid early transcript 1E (RAET1E), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
RAET1E (untagged) - Homo sapiens retinoic acid early transcript 1E (RAET1E), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of RAET1E (NM_139165) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAET1E (NM_001243327) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAET1E (NM_001243328) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAET1E (NM_001243325) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAET1E (NM_139165) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RAET1E (NM_139165) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RAET1E (NM_001243327) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RAET1E (NM_001243328) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RAET1E (NM_001243325) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RAET1E
Pathways
- Natural killer cell mediated cytotoxicity