Products

cDNA Clones (20)
Proteins (9)
Antibodies (4)
Jump to Filters
View as table Download
PACAP receptor (ADCYAP1R1) (NM_001118) Human Tagged ORF Clone Lentiviral Particle
RC215923L1V

USD 830.00

3 Weeks

Lenti ORF particles, ADCYAP1R1 (Myc-DDK tagged) - Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PACAP receptor (ADCYAP1R1) (NM_001118) Human Tagged ORF Clone Lentiviral Particle
RC215923L2V

USD 830.00

6 Weeks

Lenti ORF particles, ADCYAP1R1 (mGFP-tagged) - Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PACAP receptor (ADCYAP1R1) (NM_001118) Human Tagged ORF Clone
RC215923

USD 430.00

In Stock

ADCYAP1R1 (Myc-DDK-tagged)-Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PACAP receptor (ADCYAP1R1) (NM_001118) Human Tagged ORF Clone
RG215923

USD 470.00

In Stock

ADCYAP1R1 (GFP-tagged) - Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PACAP receptor (ADCYAP1R1) (NM_001118) Human Tagged ORF Clone
RC215923L3

USD 630.00

3 Weeks

Lenti ORF clone of Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PACAP receptor (ADCYAP1R1) (NM_001118) Human Tagged ORF Clone Lentiviral Particle
RC215923L3V

USD 830.00

6 Weeks

Lenti ORF particles, ADCYAP1R1 (Myc-DDK tagged) - Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PACAP receptor (ADCYAP1R1) (NM_001118) Human Tagged ORF Clone
RC215923L4

USD 630.00

3 Weeks

Lenti ORF clone of Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PACAP receptor (ADCYAP1R1) (NM_001118) Human Tagged ORF Clone Lentiviral Particle
RC215923L4V

USD 830.00

6 Weeks

Lenti ORF particles, ADCYAP1R1 (mGFP-tagged) - Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PACAP receptor (ADCYAP1R1) (NM_001199637) Human Tagged ORF Clone
RC232738

USD 420.00

3 Weeks

ADCYAP1R1 (Myc-DDK tagged) - Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PACAP receptor (ADCYAP1R1) (NM_001199636) Human Tagged ORF Clone
RC232856

USD 420.00

3 Weeks

ADCYAP1R1 (Myc-DDK tagged) - Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PACAP receptor (ADCYAP1R1) (NM_001199635) Human Tagged ORF Clone
RC232858

USD 420.00

3 Weeks

ADCYAP1R1 (Myc-DDK tagged) - Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PACAP receptor (ADCYAP1R1) (NM_001199637) Human Tagged ORF Clone
RG232738

USD 460.00

3 Weeks

ADCYAP1R1 (GFP-tagged) - Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PACAP receptor (ADCYAP1R1) (NM_001199636) Human Tagged ORF Clone
RG232856

USD 460.00

3 Weeks

ADCYAP1R1 (GFP-tagged) - Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PACAP receptor (ADCYAP1R1) (NM_001199635) Human Tagged ORF Clone
RG232858

USD 460.00

3 Weeks

ADCYAP1R1 (GFP-tagged) - Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PACAP receptor (ADCYAP1R1) (NM_001118) Human Untagged Clone
SC128086

USD 780.00

In Stock

ADCYAP1R1 (untagged)-Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 3

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
PACAP receptor (ADCYAP1R1) (NM_001118) Human Tagged ORF Clone
RC215923L1

USD 780.00

In Stock

Lenti ORF clone of Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PACAP receptor (ADCYAP1R1) (NM_001199635) Human Untagged Clone
SC329540

USD 500.00

In Stock

ADCYAP1R1 (untagged) - Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 1

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
PACAP receptor (ADCYAP1R1) (NM_001199637) Human Untagged Clone
SC329542

USD 450.00

In Stock

ADCYAP1R1 (untagged) - Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 4

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
PACAP receptor (ADCYAP1R1) (NM_001118) Human Tagged ORF Clone
RC215923L2

USD 630.00

3 Weeks

Lenti ORF clone of Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PACAP receptor (ADCYAP1R1) Rabbit Polyclonal Antibody
TA316517

USD 425.00

5 Days

PACAP Receptor / PAC1 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla, Gibbon
Immunogen ADCYAP1R1 / PAC1 Receptor antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human ADCYAP1R1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Elephant, Panda, Horse, Pig (89%); Bovine (83%).
PACAP receptor (ADCYAP1R1) Rabbit Polyclonal Antibody
TA341028

USD 425.00

5 Days

Rabbit Polyclonal Anti-ADCYAP1R1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ADCYAP1R1 / PAC1 Receptor antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human ADCYAP1R1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Elephant (100%); Gorilla, Panda, Pig (94%); Bovine, Dog (88%); Horse (82%).
PACAP receptor (ADCYAP1R1) Rabbit Polyclonal Antibody
TA342786

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADCYAP1R1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADCYAP1R1 antibody: synthetic peptide directed towards the C terminal of human ADCYAP1R1. Synthetic peptide located within the following region: NESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQ
PACAP receptor (ADCYAP1R1) (NM_001199636) Human Untagged Clone
SC329541

USD 500.00

3 Weeks

ADCYAP1R1 (untagged) - Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) receptor type I (ADCYAP1R1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
PACAP receptor (ADCYAP1R1) Rabbit Polyclonal Antibody
TA324123

USD 345.00

4 Weeks

Anti-ADCYAP1R1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-47 amino acids of Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I
PACAP receptor (ADCYAP1R1) ICC Control Block
TB415923

USD 1,080.00

4 Weeks

Transient overexpression of ADCYAP1R1 (NM_001118) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PACAP receptor (ADCYAP1R1) ICC Control Block
TB432738

USD 1,070.00

4 Weeks

Transient overexpression of ADCYAP1R1 (NM_001199637) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PACAP receptor (ADCYAP1R1) ICC Control Block
TB432856

USD 1,070.00

4 Weeks

Transient overexpression of ADCYAP1R1 (NM_001199636) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PACAP receptor (ADCYAP1R1) ICC Control Block
TB432858

USD 1,070.00

4 Weeks

Transient overexpression of ADCYAP1R1 (NM_001199635) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PACAP receptor (ADCYAP1R1) Cytosection
TS415923

USD 225.00

4 Weeks

Transient overexpression of ADCYAP1R1 (NM_001118) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PACAP receptor (ADCYAP1R1) Cytosection
TS415923P5

USD 889.00

4 Weeks

Transient overexpression of ADCYAP1R1 (NM_001118) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PACAP receptor (ADCYAP1R1) ICC Control Sections
TS432738P5

USD 889.00

4 Weeks

Transient overexpression of ADCYAP1R1 (NM_001199637) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PACAP receptor (ADCYAP1R1) ICC Control Sections
TS432856P5

USD 889.00

4 Weeks

Transient overexpression of ADCYAP1R1 (NM_001199636) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PACAP receptor (ADCYAP1R1) ICC Control Sections
TS432858P5

USD 889.00

4 Weeks

Transient overexpression of ADCYAP1R1 (NM_001199635) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack