Products

cDNA Clones (18)
Proteins (10)
Antibodies (3)
Jump to Filters
View as table Download
Manic Fringe (MFNG) (NM_002405) Human Tagged ORF Clone
RC211955

USD 420.00

In Stock

MFNG (Myc-DDK-tagged)-Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Manic Fringe (MFNG) (NM_001166343) Human Tagged ORF Clone
RC229860

USD 420.00

In Stock

MFNG (Myc-DDK-tagged)-Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Manic Fringe (MFNG) (NM_002405) Human Tagged ORF Clone Lentiviral Particle
RC211955L2V

USD 820.00

6 Weeks

Lenti ORF particles, MFNG (mGFP-tagged) - Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Manic Fringe (MFNG) (NM_002405) Human Tagged ORF Clone
RG211955

USD 460.00

In Stock

MFNG (GFP-tagged) - Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Manic Fringe (MFNG) (NM_002405) Human Tagged ORF Clone
RC211955L3

USD 620.00

3 Weeks

Lenti ORF clone of Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Manic Fringe (MFNG) (NM_002405) Human Tagged ORF Clone Lentiviral Particle
RC211955L3V

USD 820.00

5 Weeks

Lenti ORF particles, MFNG (Myc-DDK tagged) - Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Manic Fringe (MFNG) (NM_002405) Human Tagged ORF Clone
RC211955L4

USD 620.00

3 Weeks

Lenti ORF clone of Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Manic Fringe (MFNG) (NM_002405) Human Tagged ORF Clone Lentiviral Particle
RC211955L4V

USD 820.00

7 Weeks

Lenti ORF particles, MFNG (mGFP-tagged) - Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Manic Fringe (MFNG) (NM_001166343) Human Tagged ORF Clone
RC229860L3

USD 620.00

3 Weeks

Lenti ORF clone of Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Manic Fringe (MFNG) (NM_001166343) Human Tagged ORF Clone Lentiviral Particle
RC229860L3V

USD 820.00

6 Weeks

Lenti ORF particles, MFNG (Myc-DDK tagged) - Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Manic Fringe (MFNG) (NM_001166343) Human Tagged ORF Clone
RC229860L4

USD 620.00

3 Weeks

Lenti ORF clone of Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Manic Fringe (MFNG) (NM_001166343) Human Tagged ORF Clone Lentiviral Particle
RC229860L4V

USD 820.00

6 Weeks

Lenti ORF particles, MFNG (mGFP-tagged) - Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Manic Fringe (MFNG) (NM_001166343) Human Tagged ORF Clone
RG229860

USD 460.00

3 Weeks

MFNG (GFP-tagged) - Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Manic Fringe (MFNG) (NM_002405) Human Tagged ORF Clone
RC211955L1

USD 768.00

In Stock

Lenti ORF clone of Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Manic Fringe (MFNG) (NM_002405) Human Untagged Clone
SC118671

USD 660.00

In Stock

MFNG (untagged)-Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Manic Fringe (MFNG) (NM_002405) Human Over-expression Lysate
LY400858

USD 396.00

5 Days

Transient overexpression lysate of MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Manic Fringe (MFNG) Rabbit Polyclonal Antibody
TA346709

USD 475.00

5 Days

Rabbit Polyclonal Anti-MFNG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MFNG antibody: synthetic peptide directed towards the middle region of human MFNG. Synthetic peptide located within the following region: MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL
Manic Fringe (MFNG) Rabbit Polyclonal Antibody
TA346710

USD 475.00

5 Days

Rabbit Polyclonal Anti-MFNG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MFNG antibody: synthetic peptide directed towards the C terminal of human MFNG. Synthetic peptide located within the following region: QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP
Manic Fringe (MFNG) (NM_002405) Human Tagged ORF Clone
RC211955L2

USD 620.00

3 Weeks

Lenti ORF clone of Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Manic Fringe (MFNG) (NM_001166343) Human Over-expression Lysate
LC432860

USD 121.00

In Stock

MFNG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Manic Fringe (MFNG) (NM_001166343) Human Over-expression Lysate
LY432860

USD 396.00

In Stock

Transient overexpression lysate of MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Manic Fringe (MFNG) Rabbit Polyclonal Antibody
TA314190

USD 345.00

4 Weeks

Rabbit polyclonal anti-MFNG antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MFNG.
Manic Fringe (MFNG) (NM_002405) Human Over-expression Lysate
LC400858

USD 121.00

2 Weeks

MFNG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Manic Fringe (MFNG) (NM_001166343) Human Untagged Clone
SC328498

USD 660.00

3 Weeks

MFNG (untagged)-Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Manic Fringe (MFNG) ICC Control Block
TB411955

USD 1,070.00

4 Weeks

Transient overexpression of MFNG (NM_002405) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Manic Fringe (MFNG) ICC Control Block
TB429860

USD 1,070.00

4 Weeks

Transient overexpression of MFNG (NM_001166343) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Manic Fringe (MFNG) Cytosection
TS411955

USD 225.00

4 Weeks

Transient overexpression of MFNG (NM_002405) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Manic Fringe (MFNG) Cytosection
TS411955P5

USD 889.00

4 Weeks

Transient overexpression of MFNG (NM_002405) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Manic Fringe (MFNG) Cytosection
TS429860

USD 225.00

4 Weeks

Transient overexpression of MFNG (NM_001166343) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Manic Fringe (MFNG) Cytosection
TS429860P5

USD 889.00

4 Weeks

Transient overexpression of MFNG (NM_001166343) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack