Products

cDNA Clones (12)
Proteins (7)
Antibodies (6)
Jump to Filters
View as table Download
CDC20 (NM_001255) Human Tagged ORF Clone Lentiviral Particle
RC200911L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, CDC20 (mGFP-tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC20 (NM_001255) Human Tagged ORF Clone
RC200911

USD 420.00

In Stock

CDC20 (Myc-DDK-tagged)-Human cell division cycle 20 homolog (S. cerevisiae) (CDC20)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CDC20 (NM_001255) Human Tagged ORF Clone Lentiviral Particle
RC200911L1V

USD 820.00

3 Weeks

Lenti ORF particles, CDC20 (Myc-DDK tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CDC20 (NM_001255) Human Tagged ORF Clone Lentiviral Particle
RC200911L2V

USD 820.00

3 Weeks

Lenti ORF particles, CDC20 (mGFP-tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CDC20 (NM_001255) Human Tagged ORF Clone
RC200911L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC20 (NM_001255) Human Tagged ORF Clone Lentiviral Particle
RC200911L3V

USD 820.00

5 Weeks

Lenti ORF particles, CDC20 (Myc-DDK tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC20 (NM_001255) Human Tagged ORF Clone
RC200911L4

USD 620.00

In Stock

Lenti ORF clone of Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC20 (NM_001255) Human Tagged ORF Clone
RG200911

USD 460.00

3 Weeks

CDC20 (GFP-tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC20 (NM_001255) Human Tagged Lenti ORF Clone
RC200911L2

USD 768.00

In Stock

Lenti ORF clone of Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CDC20 (NM_001255) Human Tagged ORF Clone
RC200911L1

USD 768.00

In Stock

Lenti ORF clone of Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CDC20 Rabbit Polyclonal Antibody
TA327015

USD 275.00

3 Weeks

Rabbit anti-CDC20 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC20
CDC20 (NM_001255) Human Untagged Clone
SC119337

USD 310.00

In Stock

CDC20 (untagged)-Human cell division cycle 20 homolog (S. cerevisiae) (CDC20)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CDC20 (NM_001255) Human Over-expression Lysate
LC400503

USD 121.00

In Stock

CDC20 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CDC20 (NM_001255) Human Untagged Clone
SC320629

USD 310.00

In Stock

CDC20 (untagged)-Human cell division cycle 20 homolog (S. cerevisiae) (CDC20)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CDC20 Rabbit Polyclonal Antibody
TA311698

USD 345.00

In Stock

Rabbit polyclonal anti-CDC20 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CDC20.
CDC20 (NM_001255) Human Over-expression Lysate
LY400503

USD 396.00

5 Days

Transient overexpression lysate of cell division cycle 20 homolog (S. cerevisiae) (CDC20)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC20 Rabbit Polyclonal Antibody
TA330362

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDC20 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC20 antibody: synthetic peptide directed towards the N terminal of human CDC20. Synthetic peptide located within the following region: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSH
CDC20 Mouse Monoclonal Antibody [Clone ID: BM8.1]
TA353080L

USD 1,140.00

9 Weeks

Mouse monoclonal Anti-Phospho-cdc20 (Ser50) Clone BM8.1

Reactivities Frog, Mammalian
Conjugation Unconjugated
CDC20 (NM_001255) Human Mass Spec Standard
PH300911

USD 2,055.00

3 Weeks

CDC20 MS Standard C13 and N15-labeled recombinant protein (NP_001246)

Tag C-Myc/DDK
Expression Host HEK293
CDC20 Rabbit Polyclonal Antibody
TA321317

USD 345.00

In Stock

Anti-CDC20 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 182-480 amino acids of Human Cell division cycle protein 20 homolog
CDC20 Rabbit Polyclonal Antibody
TA321318

USD 345.00

In Stock

Anti-CDC20 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 182-480 amino acids of Human Cell division cycle protein 20 homolog
CDC20 ICC Control Block
TB400911

USD 1,070.00

4 Weeks

Transient overexpression of CDC20 (NM_001255) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDC20 Cytosection
TS400911

USD 225.00

4 Weeks

Transient overexpression of CDC20 (NM_001255) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CDC20 Cytosection
TS400911P5

USD 889.00

4 Weeks

Transient overexpression of CDC20 (NM_001255) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack