Products

cDNA Clones (39)
Proteins (20)
Antibodies (19)
Jump to Filters
View as table Download
PPP2R1B (NM_181699) Human Tagged ORF Clone
RC205346

USD 420.00

In Stock

PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP2R1B (NM_001177562) Human Tagged ORF Clone
RC230265

USD 520.00

In Stock

PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP2R1B (NM_181700) Human Tagged ORF Clone
RC230334

USD 560.00

In Stock

PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP2R1B (NM_181699) Human Tagged ORF Clone Lentiviral Particle
RC205346L1V

USD 820.00

6 Weeks

Lenti ORF particles, PPP2R1B (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PPP2R1B (NM_181699) Human Tagged ORF Clone Lentiviral Particle
RC205346L2V

USD 820.00

6 Weeks

Lenti ORF particles, PPP2R1B (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PPP2R1B (NM_181699) Human Tagged ORF Clone
RG205346

USD 460.00

In Stock

PPP2R1B (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R1B (NM_001177563) Human Tagged ORF Clone
RC230138

USD 440.00

In Stock

PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R1B (NM_181699) Human Tagged ORF Clone
RC205346L3

USD 620.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_181699) Human Tagged ORF Clone Lentiviral Particle
RC205346L3V

USD 820.00

6 Weeks

Lenti ORF particles, PPP2R1B (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_181699) Human Tagged ORF Clone Lentiviral Particle
RC205346L4V

USD 820.00

In Stock

Lenti ORF particles, PPP2R1B (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_002716) Human Tagged ORF Clone
RC215175

USD 630.00

3 Weeks

PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R1B (NM_002716) Human Tagged ORF Clone
RC215175L3

USD 830.00

8 Weeks

Lenti-ORF clone of PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_002716) Human Tagged ORF Clone Lentiviral Particle
RC215175L3V

USD 1,030.00

11 Weeks

Lenti ORF particles, PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_002716) Human Tagged ORF Clone
RC215175L4

USD 830.00

8 Weeks

Lenti-ORF clone of PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_002716) Human Tagged ORF Clone Lentiviral Particle
RC215175L4V

USD 1,030.00

11 Weeks

Lenti ORF particles, PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_001177563) Human Tagged ORF Clone
RC230138L3

USD 640.00

3 Weeks

Lenti-ORF clone of PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_001177563) Human Tagged ORF Clone Lentiviral Particle
RC230138L3V

USD 840.00

6 Weeks

Lenti ORF particles, PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_001177563) Human Tagged ORF Clone
RC230138L4

USD 640.00

3 Weeks

Lenti-ORF clone of PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_001177563) Human Tagged ORF Clone Lentiviral Particle
RC230138L4V

USD 840.00

6 Weeks

Lenti ORF particles, PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_001177562) Human Tagged ORF Clone
RC230265L3

USD 720.00

3 Weeks

Lenti-ORF clone of PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_001177562) Human Tagged ORF Clone Lentiviral Particle
RC230265L3V

USD 920.00

6 Weeks

Lenti ORF particles, PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_001177562) Human Tagged ORF Clone
RC230265L4

USD 720.00

3 Weeks

Lenti-ORF clone of PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_001177562) Human Tagged ORF Clone Lentiviral Particle
RC230265L4V

USD 920.00

6 Weeks

Lenti ORF particles, PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_181700) Human Tagged ORF Clone
RC230334L3

USD 760.00

3 Weeks

Lenti-ORF clone of PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_181700) Human Tagged ORF Clone Lentiviral Particle
RC230334L3V

USD 960.00

6 Weeks

Lenti ORF particles, PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_181700) Human Tagged ORF Clone
RC230334L4

USD 760.00

3 Weeks

Lenti-ORF clone of PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_181700) Human Tagged ORF Clone Lentiviral Particle
RC230334L4V

USD 960.00

6 Weeks

Lenti ORF particles, PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_002716) Human Tagged ORF Clone
RG215175

USD 690.00

3 Weeks

PPP2R1B (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R1B (NM_001177563) Human Tagged ORF Clone
RG230138

USD 480.00

3 Weeks

PPP2R1B (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R1B (NM_001177562) Human Tagged ORF Clone
RG230265

USD 570.00

3 Weeks

PPP2R1B (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R1B (NM_181700) Human Tagged ORF Clone
RG230334

USD 620.00

3 Weeks

PPP2R1B (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R1B (NM_181699) Human Untagged Clone
SC123371

USD 310.00

In Stock

PPP2R1B (untagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PPP2R1B Rabbit Polyclonal Antibody
TA344604

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPP2R1B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R1B antibody: synthetic peptide directed towards the N terminal of human PPP2R1B. Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ
PPP2R1B (NM_181699) Human Tagged ORF Clone
RC205346L1

USD 620.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PPP2R1B (NM_181699) Human Tagged ORF Clone
RC205346L2

USD 620.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PPP2R1B Rabbit Polyclonal Antibody
AP05041PU-N

USD 360.00

5 Days

PPP2R1B rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH
PPP2R1B Sheep Polyclonal Antibody
AP05042PU-N

USD 360.00

5 Days

PPP2R1B sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen used to the purified peptide conjugated to KLH corresponding to the sequence NH2-Phe-Ser-Gln-Val-Lys-Gly-Ala-Val-Asp-Asp-Asp-Val-Ala-Glu-COOH. This peptide antibody corresponds to N -terminal peptide of PP2A/B a regulatory subunit having a MW of 55kD.
PPP2R1B (NM_001177562) Human Over-expression Lysate
LC433265

USD 121.00

In Stock

PPP2R1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R1B (NM_181700) Human Over-expression Lysate
LC433334

USD 121.00

In Stock

PPP2R1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R1B (NM_001177562) Human Over-expression Lysate
LY433265

USD 396.00

In Stock

Transient overexpression lysate of protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R1B (NM_181700) Human Over-expression Lysate
LY433334

USD 396.00

In Stock

Transient overexpression lysate of protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R1B (NM_002716) Human Untagged Clone
SC127986

USD 1,020.00

In Stock

PPP2R1B (untagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PPP2R1B Rabbit Polyclonal Antibody
TA314375

USD 345.00

4 Weeks

Rabbit polyclonal anti-PPP2R1B antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R1B.
PPP2R1B Mouse Monoclonal Antibody [Clone ID: OTI9F3]
CF811386

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPP2R1B mouse monoclonal antibody,clone OTI9F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPP2R1B Mouse Monoclonal Antibody [Clone ID: OTI8B6]
CF811413

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPP2R1B mouse monoclonal antibody,clone OTI8B6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPP2R1B Mouse Monoclonal Antibody [Clone ID: OTI8C5]
CF811459

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPP2R1B mouse monoclonal antibody,clone OTI8C5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPP2R1B (NM_181699) Human Over-expression Lysate
LC403624

USD 121.00

2 Weeks

PPP2R1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R1B (NM_181699) Human Over-expression Lysate
LY403624

USD 396.00

5 Days

Transient overexpression lysate of protein phosphatase 2 (formerly 2A), regulatory subunit A, beta isoform (PPP2R1B), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R1B (NM_181699) Human Tagged ORF Clone
RC205346L4

USD 620.00

In Stock

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R1B (NM_001177563) Human Untagged Clone
SC328776

USD 790.00

3 Weeks

PPP2R1B (untagged)-Human protein phosphatase 2 regulatory subunit A beta (PPP2R1B) transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin