Products

cDNA Clones (22)
Proteins (13)
Antibodies (2)
Jump to Filters
View as table Download
ACSL3 (NM_004457) Human Tagged ORF Clone
RC208032

USD 420.00

In Stock

ACSL3 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACSL3 (NM_203372) Human Tagged ORF Clone
RC217537

USD 420.00

In Stock

ACSL3 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACSL3 (NM_004457) Human Tagged ORF Clone Lentiviral Particle
RC208032L1V

USD 820.00

3 Weeks

Lenti ORF particles, ACSL3 (Myc-DDK tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ACSL3 (NM_004457) Human Tagged ORF Clone Lentiviral Particle
RC208032L2V

USD 820.00

6 Weeks

Lenti ORF particles, ACSL3 (mGFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ACSL3 (NM_203372) Human Tagged ORF Clone Lentiviral Particle
RC217537L1V

USD 820.00

6 Weeks

Lenti ORF particles, ACSL3 (Myc-DDK tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ACSL3 (NM_203372) Human Tagged ORF Clone Lentiviral Particle
RC217537L2V

USD 820.00

6 Weeks

Lenti ORF particles, ACSL3 (mGFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ACSL3 (NM_004457) Human Tagged ORF Clone
RG208032

USD 460.00

In Stock

ACSL3 (GFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACSL3 (NM_203372) Human Tagged ORF Clone
RG217537

USD 460.00

In Stock

ACSL3 (GFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACSL3 (NM_004457) Human Tagged ORF Clone
RC208032L3

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACSL3 (NM_004457) Human Tagged ORF Clone Lentiviral Particle
RC208032L3V

USD 820.00

5 Weeks

Lenti ORF particles, ACSL3 (Myc-DDK tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACSL3 (NM_004457) Human Tagged ORF Clone
RC208032L4

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACSL3 (NM_004457) Human Tagged ORF Clone Lentiviral Particle
RC208032L4V

USD 820.00

7 Weeks

Lenti ORF particles, ACSL3 (mGFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACSL3 (NM_203372) Human Tagged ORF Clone
RC217537L3

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACSL3 (NM_203372) Human Tagged ORF Clone Lentiviral Particle
RC217537L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACSL3 (Myc-DDK tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACSL3 (NM_203372) Human Tagged ORF Clone
RC217537L4

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACSL3 (NM_203372) Human Tagged ORF Clone Lentiviral Particle
RC217537L4V

USD 820.00

6 Weeks

Lenti ORF particles, ACSL3 (mGFP-tagged) - Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACSL3 Rabbit Polyclonal Antibody
TA339415

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
ACSL3 (NM_203372) Human Untagged Clone
SC126917

USD 310.00

In Stock

ACSL3 (untagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ACSL3 (NM_004457) Human Untagged Clone
SC117368

USD 310.00

In Stock

ACSL3 (untagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ACSL3 (NM_004457) Human Tagged ORF Clone
RC208032L1

USD 620.00

In Stock

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ACSL3 (NM_004457) Human Tagged ORF Clone
RC208032L2

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ACSL3 (NM_203372) Human Tagged ORF Clone
RC217537L1

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ACSL3 (NM_203372) Human Tagged ORF Clone
RC217537L2

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ACSL3 (NM_203372) Human Over-expression Lysate
LY403709

USD 396.00

5 Days

Transient overexpression lysate of acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACSL3 (C-term) Rabbit Polyclonal Antibody
AP50062PU-N

USD 450.00

2 Weeks

ACSL3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 527-556 amino acids from the C-terminal region of human ACSL3
ACSL3 (NM_004457) Human Over-expression Lysate
LY417974

USD 396.00

5 Days

Transient overexpression lysate of acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACSL3 (NM_203372) Human Over-expression Lysate
LC403709

USD 121.00

2 Weeks

ACSL3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACSL3 (NM_004457) Human Over-expression Lysate
LC417974

USD 121.00

2 Weeks

ACSL3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACSL3 (NM_004457) Human Mass Spec Standard
PH308032

USD 2,055.00

3 Weeks

ACSL3 MS Standard C13 and N15-labeled recombinant protein (NP_004448)

Tag C-Myc/DDK
Expression Host HEK293
ACSL3 (NM_203372) Human Mass Spec Standard
PH317537

USD 2,055.00

3 Weeks

ACSL3 MS Standard C13 and N15-labeled recombinant protein (NP_976251)

Tag C-Myc/DDK
Expression Host HEK293
ACSL3 ICC Control Block
TB408032

USD 1,070.00

4 Weeks

Transient overexpression of ACSL3 (NM_004457) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACSL3 ICC Control Block
TB417537

USD 1,070.00

4 Weeks

Transient overexpression of ACSL3 (NM_203372) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACSL3 Cytosection
TS408032

USD 225.00

4 Weeks

Transient overexpression of ACSL3 (NM_004457) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ACSL3 Cytosection
TS408032P5

USD 889.00

4 Weeks

Transient overexpression of ACSL3 (NM_004457) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ACSL3 Cytosection
TS417537

USD 225.00

4 Weeks

Transient overexpression of ACSL3 (NM_203372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ACSL3 Cytosection
TS417537P5

USD 889.00

4 Weeks

Transient overexpression of ACSL3 (NM_203372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack