Germany
Japan
United Kingdom
China
Lenti ORF particles, CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Products
View as table DownloadLenti ORF particles, CYP8B1 (mGFP-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CYP8B1 (mGFP-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP8B1 (mGFP-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CYP8B1 (GFP-tagged) - Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CYP8B1 (untagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of CYP8B1 (mGFP-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal CYP8B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
Rabbit Polyclonal Anti-CYP8B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP8B1 antibody: synthetic peptide directed towards the middle region of human CYP8B1. Synthetic peptide located within the following region: SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP |
Transient overexpression of CYP8B1 (NM_004391) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP8B1 (NM_004391) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP8B1 (NM_004391) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYP8B1
Pathways
- PPAR signaling pathway