Lenti ORF particles, CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CYP8B1 (mGFP-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CYP8B1 (mGFP-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP8B1 (mGFP-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CYP8B1 (GFP-tagged) - Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
Lenti-ORF clone of CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CYP8B1 (untagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti-ORF clone of CYP8B1 (mGFP-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal CYP8B1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
Mouse monoclonal Anti-Cytochrome P450 8B1 Clone M15-P3B7
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CYP8B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP8B1 antibody: synthetic peptide directed towards the middle region of human CYP8B1. Synthetic peptide located within the following region: SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP |
Transient overexpression of CYP8B1 (NM_004391) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP8B1 (NM_004391) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP8B1 (NM_004391) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack