Germany
Japan
United Kingdom
China
Cyp8b1 (Myc-DDK-tagged) - Mouse cytochrome P450, family 8, subfamily b, polypeptide 1 (Cyp8b1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CYP8B1 (mGFP-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CYP8B1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN420836 is the updated version of KN220836.
Cyp8b1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504186 is the updated version of KN304186.
Cyp8b1 (GFP-tagged) - Mouse cytochrome P450, family 8, subfamily b, polypeptide 1 (Cyp8b1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cyp8b1 (Myc-DDK-tagged) - Mouse cytochrome P450, family 8, subfamily b, polypeptide 1 (Cyp8b1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cyp8b1 (Myc-DDK-tagged) - Mouse cytochrome P450, family 8, subfamily b, polypeptide 1 (Cyp8b1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cyp8b1 (mGFP-tagged) - Mouse cytochrome P450, family 8, subfamily b, polypeptide 1 (Cyp8b1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cyp8b1 (GFP-tagged) - Mouse cytochrome P450, family 8, subfamily b, polypeptide 1 (Cyp8b1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CYP8B1 (mGFP-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP8B1 (mGFP-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CYP8B1 (GFP-tagged) - Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Cyp8b1 (Myc-DDK-tagged ORF) - Rat cytochrome P450, family 8, subfamily b, polypeptide 1 (Cyp8b1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cyp8b1 (Myc-DDK-tagged ORF) - Rat cytochrome P450, family 8, subfamily b, polypeptide 1 (Cyp8b1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cyp8b1 (Myc-DDK-tagged ORF) - Rat cytochrome P450, family 8, subfamily b, polypeptide 1 (Cyp8b1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cyp8b1 (mGFP-tagged ORF) - Rat cytochrome P450, family 8, subfamily b, polypeptide 1 (Cyp8b1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cyp8b1 (GFP-tagged ORF) - Rat cytochrome P450, family 8, subfamily b, polypeptide 1 (Cyp8b1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cyp8b1 (untagged) - Mouse cytochrome P450, family 8, subfamily b, polypeptide 1 (cDNA clone MGC:13798 IMAGE:4162964), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CYP8B1 (Myc-DDK-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CYP8B1 (untagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CYP8B1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lenti-ORF clone of CYP8B1 (mGFP-tagged)-Human cytochrome P450, family 8, subfamily B, polypeptide 1 (CYP8B1)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal CYP8B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
CYP8B1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Cyp8b1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-CYP8B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP8B1 antibody: synthetic peptide directed towards the middle region of human CYP8B1. Synthetic peptide located within the following region: SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP |
Cyp8b1 - Rat, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
CYP8B1 CRISPRa kit - CRISPR gene activation of human cytochrome P450 family 8 subfamily B member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cyp8b1 CRISPRa kit - CRISPR gene activation of mouse cytochrome P450, family 8, subfamily b, polypeptide 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CYP8B1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CYP8B1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qSTAR qPCR primer pairs against Mus musculus gene Cyp8b1
Cyp8b1 (untagged ORF) - Rat cytochrome P450, family 8, subfamily b, polypeptide 1 (Cyp8b1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Cyp8b1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
CYP8B1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CYP8B1 |
Transient overexpression of CYP8B1 (NM_004391) in HEK293T cells paraffin embedded controls for ICC/IHC staining
CYP8B1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Cyp8b1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Cyp8b1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Cyp8b1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Cyp8b1 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
CYP8B1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Cyp8b1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Active filters
Target Symbol
- CYP8B1