Products

View as table Download

USD 98.00

USD 390.00

In Stock

UBE2L3 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, UBE2L3 (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, UBE2L3 (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

UBE2L3 (GFP-tagged) - Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, UBE2L3 (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UBE2L3 (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

UBE2L3 (Myc-DDK tagged) - Homo sapiens ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

UBE2L3 (Myc-DDK tagged) - Homo sapiens ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

UBE2L3 (GFP-tagged) - Homo sapiens ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

UBE2L3 (GFP-tagged) - Homo sapiens ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

UBE2L3 (untagged)-Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-BSDC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BSDC1 antibody: synthetic peptide directed towards the N terminal of human BSDC1. Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC

Rabbit Polyclonal antibody to UBE2L3 (ubiquitin-conjugating enzyme E2L 3)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 92 and 154 of UBE2L3 (Uniprot ID#P68036)

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

UBE2L3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Goat Polyclonal Antibody against UBE2L3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-EFTKKYGEKRPVD, from the C Terminus of the protein sequence according to NP_003338.

UBE2L3 MS Standard C13 and N15-labeled recombinant protein (NP_003338)

Tag C-Myc/DDK
Expression Host HEK293

UBE2L3 (untagged) - Homo sapiens ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 4

Vector pCMV6 series
Tag Tag Free

UBE2L3 (untagged) - Homo sapiens ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 3

Vector pCMV6 series
Tag Tag Free

UBE2L3 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UBE2L3

UBE2L3 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human UBE2L3

Rabbit Polyclonal anti-UBE2L3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UBE2L3

Rabbit Polyclonal anti-UBE2L3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UBE2L3

USD 1,040.00

4 Weeks

Transient overexpression of UBE2L3 (NM_003347) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of UBE2L3 (NM_001256356) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of UBE2L3 (NM_001256355) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of UBE2L3 (NM_003347) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of UBE2L3 (NM_003347) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of UBE2L3 (NM_001256356) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of UBE2L3 (NM_001256355) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack