UBE2L3 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UBE2L3 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, UBE2L3 (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, UBE2L3 (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
UBE2L3 (GFP-tagged) - Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, UBE2L3 (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UBE2L3 (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
UBE2L3 (Myc-DDK tagged) - Homo sapiens ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UBE2L3 (Myc-DDK tagged) - Homo sapiens ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UBE2L3 (GFP-tagged) - Homo sapiens ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
UBE2L3 (GFP-tagged) - Homo sapiens ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
UBE2L3 (untagged)-Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-BSDC1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BSDC1 antibody: synthetic peptide directed towards the N terminal of human BSDC1. Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC |
Rabbit Polyclonal antibody to UBE2L3 (ubiquitin-conjugating enzyme E2L 3)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 92 and 154 of UBE2L3 (Uniprot ID#P68036) |
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
UBE2L3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Polyclonal Antibody against UBE2L3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EFTKKYGEKRPVD, from the C Terminus of the protein sequence according to NP_003338. |
UBE2L3 MS Standard C13 and N15-labeled recombinant protein (NP_003338)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
UBE2L3 (untagged) - Homo sapiens ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
UBE2L3 (untagged) - Homo sapiens ubiquitin-conjugating enzyme E2L 3 (UBE2L3), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
UBE2L3 Antibody - middle region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UBE2L3 |
UBE2L3 Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human UBE2L3 |
Rabbit Polyclonal anti-UBE2L3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UBE2L3 |
Rabbit Polyclonal anti-UBE2L3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UBE2L3 |
Transient overexpression of UBE2L3 (NM_003347) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UBE2L3 (NM_001256356) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UBE2L3 (NM_001256355) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UBE2L3 (NM_003347) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of UBE2L3 (NM_003347) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of UBE2L3 (NM_001256356) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of UBE2L3 (NM_001256355) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack