Germany
Japan
United Kingdom
China
VDAC2 (Myc-DDK-tagged)-Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
VDAC2 (Myc-DDK-tagged)-Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
VDAC2 (GFP-tagged) - Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, VDAC2 (Myc-DDK tagged) - Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, VDAC2 (mGFP-tagged) - Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
VDAC2 (GFP-tagged) - Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VDAC2 (Myc-DDK-tagged)-Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VDAC2 (Myc-DDK tagged) - Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, VDAC2 (mGFP-tagged) - Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VDAC2 (Myc-DDK tagged) - Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VDAC2 (mGFP-tagged) - Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VDAC2 (Myc-DDK tagged) - Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VDAC2 (mGFP-tagged) - Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
VDAC2 (GFP-tagged) - Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
VDAC2 (untagged)-Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-VDAC2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: A synthesized peptide derived from human VDAC2 |
Lenti ORF clone of Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
VDAC2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-VDAC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV |
Transient overexpression lysate of voltage-dependent anion channel 2 (VDAC2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Polyclonal Antibody against VDAC2 (C Terminus)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GHKVGLALELEA, from the C Terminus of the protein sequence according to NP_003366.2. |
Goat Polyclonal Antibody against VDAC2 (Internal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DSAKSKLTRNN, from the internal region of the protein sequence according to NP_003366.2. |
Rabbit Polyclonal VDAC2/3 Antibody
| Applications | WB |
| Reactivities | Human, Bovine, Canine, Feline, Primate |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 120-132 (KKSGKIKSSYKRE) of human VDAC2 protein were used as the immunogen. |
Rabbit Polyclonal Anti-VDAC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN |
Purified recombinant protein of Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
VDAC2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human voltage-dependent anion channel 2 (VDAC2), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
VDAC2 (untagged)-Human voltage-dependent anion channel 2 (VDAC2) nuclear gene encoding mitochondrial protein transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
VDAC2 (untagged)-Human voltage-dependent anion channel 2 (VDAC2) nuclear gene encoding mitochondrial protein transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anti-VDAC2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 283-294 amino acids of human voltage-dependent anion channel 2 |
Transient overexpression of VDAC2 (NM_003375) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VDAC2 (NM_001184823) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VDAC2 (NM_001184783) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VDAC2 (NM_003375) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of VDAC2 (NM_003375) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of VDAC2 (NM_001184823) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of VDAC2 (NM_001184823) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of VDAC2 (NM_001184783) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of VDAC2 (NM_001184783) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- VDAC2
Pathways
- Parkinson's disease