Products

cDNA Clones (25)
Proteins (14)
Antibodies (7)
Jump to Filters
View as table Download
Cullin 2 (CUL2) (NM_003591) Human Tagged ORF Clone
RG203304

USD 460.00

In Stock

CUL2 (GFP-tagged) - Human cullin 2 (CUL2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cullin 2 (CUL2) (NM_001198777) Human Tagged ORF Clone
RC233114

USD 420.00

In Stock

CUL2 (Myc-DDK tagged) - Homo sapiens cullin 2 (CUL2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cullin 2 (CUL2) (NM_003591) Human Tagged ORF Clone
RC203304L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cullin 2 (CUL2), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cullin 2 (CUL2) (NM_001198779) Human Tagged ORF Clone
RC231403

USD 850.00

3 Weeks

CUL2 (Myc-DDK-tagged)-Human cullin 2 (CUL2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cullin 2 (CUL2) (NM_001198779) Human Tagged ORF Clone
RC231403L3

USD 1,050.00

4 Weeks

Lenti-ORF clone of CUL2 (Myc-DDK-tagged)-Human cullin 2 (CUL2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cullin 2 (CUL2) (NM_001198779) Human Tagged ORF Clone
RC231403L4

USD 1,050.00

4 Weeks

Lenti-ORF clone of CUL2 (mGFP-tagged)-Human cullin 2 (CUL2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cullin 2 (CUL2) (NM_001198778) Human Tagged ORF Clone
RC231406

USD 800.00

3 Weeks

CUL2 (Myc-DDK-tagged)-Human cullin 2 (CUL2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cullin 2 (CUL2) (NM_001198778) Human Tagged ORF Clone
RC231406L3

USD 1,000.00

4 Weeks

Lenti-ORF clone of CUL2 (Myc-DDK-tagged)-Human cullin 2 (CUL2), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cullin 2 (CUL2) (NM_001198778) Human Tagged ORF Clone
RC231406L4

USD 1,000.00

4 Weeks

Lenti-ORF clone of CUL2 (mGFP-tagged)-Human cullin 2 (CUL2), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cullin 2 (CUL2) (NM_001198779) Human Tagged ORF Clone
RG231403

USD 940.00

5 Weeks

CUL2 (GFP-tagged) - Human cullin 2 (CUL2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cullin 2 (CUL2) (NM_001198778) Human Tagged ORF Clone
RG231406

USD 880.00

5 Weeks

CUL2 (GFP-tagged) - Human cullin 2 (CUL2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cullin 2 (CUL2) (NM_001198777) Human Tagged ORF Clone
RG233114

USD 460.00

3 Weeks

CUL2 (GFP-tagged) - Homo sapiens cullin 2 (CUL2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cullin 2 (CUL2) Rabbit Polyclonal Antibody
TA332601

USD 275.00

3 Weeks

Rabbit anti-CUL2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CUL2
Cullin 2 (CUL2) (NM_003591) Human Over-expression Lysate
LY418560

USD 396.00

In Stock

Transient overexpression lysate of cullin 2 (CUL2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cullin 2 (CUL2) (NM_003591) Human Untagged Clone
SC321610

USD 310.00

In Stock

CUL2 (untagged)-Human cullin 2 (CUL2), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Cullin 2 (CUL2) Rabbit Polyclonal Antibody
TA314751

USD 345.00

In Stock

Rabbit polyclonal anti-Cullin 2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cullin 2.
Cullin 2 (CUL2) Rabbit Polyclonal Antibody
TA347363

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Cullin 2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cullin 2 Antibody: A synthesized peptide derived from human Cullin 2
Cullin 2 (CUL2) Rabbit Polyclonal Antibody
AP06078PU-N

USD 370.00

2 Weeks

Cullin 2 (CUL2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Cullin 2 (CUL2) (NM_003591) Human Tagged ORF Clone
RC203304L2

USD 620.00

3 Weeks

Lenti ORF clone of Human cullin 2 (CUL2), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Cullin 2 (CUL2) (NM_003591) Human Over-expression Lysate
LC418560

USD 121.00

In Stock

CUL2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cullin 2 (CUL2) Rabbit Polyclonal Antibody
TA319397

USD 530.00

5 Days

Rabbit polyclonal anti-Cul2 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 733-745 of Human Cul2 (C-terminus) coupled to KLH.
Cullin 2 (CUL2) Rabbit Polyclonal Antibody
TA330364

USD 375.00

5 Days

Rabbit Polyclonal Anti-CUL2 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CUL2 antibody: synthetic peptide directed towards the middle region of human CUL2. Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA
Cullin 2 (CUL2) (NM_003591) Human Mass Spec Standard
PH303304

USD 2,055.00

3 Weeks

CUL2 MS Standard C13 and N15-labeled recombinant protein (NP_003582)

Tag C-Myc/DDK
Expression Host HEK293
Cullin 2 (CUL2) (NM_001198777) Human Untagged Clone
SC329474

USD 750.00

4 Weeks

CUL2 (untagged) - Homo sapiens cullin 2 (CUL2), transcript variant 4

Vector pCMV6 series
Tag Tag Free
Cullin 2 (CUL2) Rabbit Polyclonal Antibody
TA322839

USD 345.00

In Stock

Anti-CUL2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 214-228 amino acids of Human cullin 2
Cullin 2 (CUL2) (NM_003591) ICC Control Block
TB403304

USD 1,070.00

4 Weeks

Transient overexpression of CUL2 (NM_003591) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cullin 2 (CUL2) (NM_001198779) ICC Control Block
TB431403

USD 1,500.00

4 Weeks

Transient overexpression of CUL2 (NM_001198779) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cullin 2 (CUL2) (NM_001198778) ICC Control Block
TB431406

USD 1,450.00

4 Weeks

Transient overexpression of CUL2 (NM_001198778) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cullin 2 (CUL2) (NM_001198777) ICC Control Block
TB433114

USD 1,070.00

4 Weeks

Transient overexpression of CUL2 (NM_001198777) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cullin 2 (CUL2) Cytosection
TS403304

USD 225.00

4 Weeks

Transient overexpression of CUL2 (NM_003591) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Cullin 2 (CUL2) Cytosection
TS403304P5

USD 889.00

4 Weeks

Transient overexpression of CUL2 (NM_003591) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Cullin 2 (CUL2) ICC Control Sections
TS431403P5

USD 889.00

4 Weeks

Transient overexpression of CUL2 (NM_001198779) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Cullin 2 (CUL2) ICC Control Sections
TS431406P5

USD 889.00

4 Weeks

Transient overexpression of CUL2 (NM_001198778) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Cullin 2 (CUL2) Cytosection
TS433114

USD 225.00

4 Weeks

Transient overexpression of CUL2 (NM_001198777) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Cullin 2 (CUL2) Cytosection
TS433114P5

USD 889.00

4 Weeks

Transient overexpression of CUL2 (NM_001198777) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack