USD 530.00
In Stock
GPI (Myc-DDK-tagged)-Human glucose-6-phosphate isomerase (GPI), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 530.00
In Stock
GPI (Myc-DDK-tagged)-Human glucose-6-phosphate isomerase (GPI), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GPI (Myc-DDK-tagged)-Human glucose-6-phosphate isomerase (GPI), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 823.00
In Stock
Recombinant protein of human glucose phosphate isomerase (GPI)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 880.00
3 Weeks
Lenti ORF particles, GPI (Myc-DDK tagged) - Human glucose-6-phosphate isomerase (GPI), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 880.00
6 Weeks
Lenti ORF particles, GPI (mGFP-tagged) - Human glucose-6-phosphate isomerase (GPI), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 930.00
3 Weeks
Lenti ORF particles, GPI (Myc-DDK-tagged)-Human glucose-6-phosphate isomerase (GPI), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 930.00
6 Weeks
Lenti ORF particles, GPI (mGFP-tagged)-Human glucose-6-phosphate isomerase (GPI), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 680.00
3 Weeks
Lenti ORF clone of Human glucose-6-phosphate isomerase (GPI), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 880.00
6 Weeks
Lenti ORF particles, GPI (Myc-DDK tagged) - Human glucose-6-phosphate isomerase (GPI), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 680.00
3 Weeks
Lenti ORF clone of Human glucose-6-phosphate isomerase (GPI), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 880.00
6 Weeks
Lenti ORF particles, GPI (mGFP-tagged) - Human glucose-6-phosphate isomerase (GPI), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 730.00
3 Weeks
Lenti-ORF clone of GPI (Myc-DDK-tagged)-Human glucose-6-phosphate isomerase (GPI), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 930.00
5 Weeks
Lenti ORF particles, GPI (Myc-DDK-tagged)-Human glucose-6-phosphate isomerase (GPI), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 730.00
3 Weeks
Lenti-ORF clone of GPI (mGFP-tagged)-Human glucose-6-phosphate isomerase (GPI), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 930.00
7 Weeks
Lenti ORF particles, GPI (mGFP-tagged)-Human glucose-6-phosphate isomerase (GPI), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 480.00
3 Weeks
GPI (myc-DDK-tagged) - Human glucose-6-phosphate isomerase (GPI), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 480.00
3 Weeks
GPI (myc-DDK-tagged) - Human glucose-6-phosphate isomerase (GPI), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GPI (GFP-tagged) - Human glucose-6-phosphate isomerase (GPI), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 580.00
3 Weeks
GPI (GFP-tagged) - Human glucose-6-phosphate isomerase (GPI), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 840.00
In Stock
Lenti ORF clone of Human glucose-6-phosphate isomerase (GPI), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
GPI (untagged)-Human glucose-6-phosphate isomerase (GPI), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Glucose-6-phosphate isomerase (GPI) (1-558, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Glucose-6-phosphate isomerase (GPI) (1-558, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Glucose-6-phosphate isomerase (GPI) (1-558, His-tag) human protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Glucose-6-phosphate isomerase (GPI) (1-558, His-tag) human protein, 20 µg
Tag | His-tag |
Expression Host | E. coli |
USD 396.00
In Stock
Transient overexpression lysate of glucose phosphate isomerase (GPI)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 680.00
3 Weeks
Lenti ORF clone of Human glucose-6-phosphate isomerase (GPI), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 970.00
In Stock
GPI (untagged)-Human glucose-6-phosphate isomerase (GPI) transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Glucose 6 phosphate isomerase Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
USD 450.00
2 Weeks
Glucose 6 phosphate isomerase (GPI) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 452~481 amino acids from the C-terminal region of human GPI |
USD 121.00
In Stock
GPI HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 121.00
In Stock
GPI HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 396.00
In Stock
Transient overexpression lysate of glucose-6-phosphate isomerase (GPI), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-GPI Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPI antibody: synthetic peptide directed towards the C terminal of human GPI. Synthetic peptide located within the following region: SFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ |
Rabbit Polyclonal Anti-GPI Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPI antibody: synthetic peptide directed towards the C terminal of human GPI. Synthetic peptide located within the following region: EALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLT |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI8G7 (formerly 8G7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI7G10 (formerly 7G10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 2,055.00
3 Weeks
GPI MS Standard C13 and N15-labeled recombinant protein (NP_000166)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
USD 520.00
2 Weeks
GPI (GFP-tagged) - Human glucose-6-phosphate isomerase (GPI), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 520.00
2 Weeks
GPI (GFP-tagged) - Human glucose-6-phosphate isomerase (GPI), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GPI (untagged) - Human glucose-6-phosphate isomerase (GPI), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GPI (untagged) - Human glucose-6-phosphate isomerase (GPI), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
USD 379.00
In Stock
Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |