H6PD (Myc-DDK-tagged)-Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
H6PD (Myc-DDK-tagged)-Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, H6PD (Myc-DDK tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, H6PD (mGFP-tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
H6PD (GFP-tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, H6PD (Myc-DDK tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, H6PD (mGFP-tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
H6PD (myc-DDK-tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
H6PD (untagged)-Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
(untagged)-Human cDNA: FLJ20895 fis, clone ADKA03483
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
H6PD HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
(untagged)-Human cDNA: FLJ22807 fis, clone KAIA2887
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-H6PD Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H6PD antibody: synthetic peptide directed towards the N terminal of human H6PD. Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW |
Carrier-free (BSA/glycerol-free) H6PD mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
H6PD MS Standard C13 and N15-labeled recombinant protein (NP_004276)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
H6PD (GFP-tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
H6PD (untagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Anti-H6PD mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-H6PD mouse monoclonal antibody, clone OTI2C12 (formerly 2C12), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-H6PD mouse monoclonal antibody, clone OTI2C12 (formerly 2C12), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-H6PD mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Anti-H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Biotin |
Anti-H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | HRP |
Anti-H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Transient overexpression of H6PD (NM_004285) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of H6PD (NM_001282587) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of H6PD (NM_004285) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of H6PD (NM_004285) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of H6PD (NM_001282587) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack