Products

View as table Download

H6PD (Myc-DDK-tagged)-Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, H6PD (Myc-DDK tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, H6PD (mGFP-tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

H6PD (GFP-tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, H6PD (Myc-DDK tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, H6PD (mGFP-tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

H6PD (myc-DDK-tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

H6PD (untagged)-Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

(untagged)-Human cDNA: FLJ20895 fis, clone ADKA03483

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

H6PD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Transient overexpression lysate of hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

(untagged)-Human cDNA: FLJ22807 fis, clone KAIA2887

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-H6PD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H6PD antibody: synthetic peptide directed towards the N terminal of human H6PD. Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW

Carrier-free (BSA/glycerol-free) H6PD mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

H6PD MS Standard C13 and N15-labeled recombinant protein (NP_004276)

Tag C-Myc/DDK
Expression Host HEK293

H6PD (GFP-tagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

H6PD (untagged) - Human hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) (H6PD), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Anti-H6PD mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-H6PD mouse monoclonal antibody, clone OTI2C12 (formerly 2C12), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-H6PD mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

Anti-H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey
Conjugation Biotin

Anti-H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey
Conjugation HRP

Anti-H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

Transient overexpression of H6PD (NM_004285) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of H6PD (NM_001282587) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of H6PD (NM_004285) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of H6PD (NM_004285) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of H6PD (NM_001282587) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack