MAPK11 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 11 (MAPK11)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAPK11 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 11 (MAPK11)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human mitogen-activated protein kinase 11 (MAPK11)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, MAPK11 (Myc-DDK tagged) - Human mitogen-activated protein kinase 11 (MAPK11), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MAPK11 (mGFP-tagged) - Human mitogen-activated protein kinase 11 (MAPK11), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
MAPK11 (GFP-tagged) - Human mitogen-activated protein kinase 11 (MAPK11)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human mitogen-activated protein kinase 11 (MAPK11), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAPK11 (Myc-DDK tagged) - Human mitogen-activated protein kinase 11 (MAPK11), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human mitogen-activated protein kinase 11 (MAPK11), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAPK11 (mGFP-tagged) - Human mitogen-activated protein kinase 11 (MAPK11), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human mitogen-activated protein kinase 11 (MAPK11), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
MAPK11 (untagged)-Human mitogen-activated protein kinase 11 (MAPK11)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of mitogen-activated protein kinase 11 (MAPK11)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human mitogen-activated protein kinase 11 (MAPK11), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
MAPK11 (untagged)-Human mitogen-activated protein kinase 11 (MAPK11)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
MAPK11 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
MAP kinase p38 beta / MAPK11 (1-364, His-tag) human recombinant protein, 10 µg
Tag | His-tag |
Expression Host | E. coli |
Rabbit polyclonal Anti-Mapk11 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Mapk11 antibody is: synthetic peptide directed towards the N-terminal region of Rat Mapk11. Synthetic peptide located within the following region: VPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTY |
MAP kinase p38 beta / MAPK11 (1-364, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MAPK11 MS Standard C13 and N15-labeled recombinant protein (NP_002742)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-MAPK11 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAPK11 |
Anti-MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of MAPK11 (NM_002751) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAPK11 (NM_002751) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAPK11 (NM_002751) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack