Products

View as table Download

PSMD6 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)

Tag C-Myc/DDK
Expression Host HEK293T

PSMD6 (GFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PSMD6 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PSMD6 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PSMD6 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PSMD6 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PSMD6 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PSMD6 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PSMD6 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PSMD6 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PSMD6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PSMD6 (untagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-PSMD6 antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PSMD6.

Rabbit Polyclonal Anti-PSMD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD6 antibody: synthetic peptide directed towards the N terminal of human PSMD6. Synthetic peptide located within the following region: YEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDA

Rabbit Polyclonal Anti-PSMD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD6 antibody: synthetic peptide directed towards the N terminal of human PSMD6. Synthetic peptide located within the following region: PLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMA

PSMD6 MS Standard C13 and N15-labeled recombinant protein (NP_055629)

Tag C-Myc/DDK
Expression Host HEK293

(untagged)-Human cDNA FLJ30648 fis, clone CTONG2006449, moderately similar to Drosophila melanogaster 26S proteasome regulatory complex subunit p42A mRNA

Vector pCMV6 series
Tag Tag Free

PSMD6 (untagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 3

Vector pCMV6 series
Tag Tag Free

PSMD6 (untagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 4

Vector pCMV6 series
Tag Tag Free

PSMD6 (untagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 1

Vector pCMV6 series
Tag Tag Free

Anti-PSMD6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6

Anti-PSMD6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6

Transient overexpression of PSMD6 (NM_014814) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PSMD6 (NM_001271781) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PSMD6 (NM_001271780) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PSMD6 (NM_001271779) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of PSMD6 (NM_014814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PSMD6 (NM_014814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PSMD6 (NM_001271781) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PSMD6 (NM_001271780) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PSMD6 (NM_001271779) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack