Germany
Japan
United Kingdom
China
PSMD6 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
PSMD6 (GFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSMD6 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSMD6 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PSMD6 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMD6 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMD6 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMD6 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMD6 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMD6 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PSMD6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PSMD6 (untagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-PSMD6 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PSMD6. |
Rabbit Polyclonal Anti-PSMD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD6 antibody: synthetic peptide directed towards the N terminal of human PSMD6. Synthetic peptide located within the following region: YEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDA |
Rabbit Polyclonal Anti-PSMD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD6 antibody: synthetic peptide directed towards the N terminal of human PSMD6. Synthetic peptide located within the following region: PLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMA |
PSMD6 MS Standard C13 and N15-labeled recombinant protein (NP_055629)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
(untagged)-Human cDNA FLJ30648 fis, clone CTONG2006449, moderately similar to Drosophila melanogaster 26S proteasome regulatory complex subunit p42A mRNA
| Vector | pCMV6 series |
| Tag | Tag Free |
PSMD6 (untagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
PSMD6 (untagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
PSMD6 (untagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
Anti-PSMD6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 |
Anti-PSMD6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 |
Transient overexpression of PSMD6 (NM_014814) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSMD6 (NM_001271781) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSMD6 (NM_001271780) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSMD6 (NM_001271779) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSMD6 (NM_014814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSMD6 (NM_014814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PSMD6 (NM_001271781) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PSMD6 (NM_001271780) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PSMD6 (NM_001271779) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PSMD6
Pathways
- Proteasome